Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
35 projects found  

1 accessions found for Geobacter sulfurreducens KN400  

Data for CP002031  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP002031.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP002031_0655 CDS_695770-696840 60.6 1.2e-17 1
CP002031_3114 CDS_3440133-3438652 55.3 4.4e-16 1
CP002031_1264 CDS_1379439-1380611 51.1 7.3e-15 1
CP002031_0225 CDS_227710-229977 30.5 8.5e-09 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP002031_0655 1/1 142 207 .. 1 70 [] 60.6 1.2e-17
CP002031_3114 1/1 263 330 .. 1 70 [] 55.3 4.4e-16
CP002031_1264 1/1 183 247 .. 1 70 [] 51.1 7.3e-15
CP002031_0225 1/1 553 620 .. 2 70 .] 30.5 8.5e-09

Alignments of top-scoring domains:
CP002031_0655: domain 1 of 1, from 142 to 207: score 60.6, E = 1.2e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIA ELHD vgQ+L+++ l+l+ ++ d r+ ++ei
CP002031_0 142 ERSRIAGELHDQVGQNLFLAGLKLGSLKISS--LGD--DDRRVVEEI 184

relarealaevRrllgdLRpaal<-*
r+l+ al+++R l +LRp+ l
CP002031_0 185 RHLIGGALQDIRSLTCQLRPPLL 207

CP002031_3114: domain 1 of 1, from 263 to 330: score 55.3, E = 4.4e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R++RELHD +gQ L a+k++ ++++ l + + ++++l +
CP002031_3 263 ERKRLSRELHDDLGQLLNALKIGFDTLAEDL--RQPSHDVQDRLWYL 307

relarealaevRrllgdLRpaal<-*
e ++ ++ +Rrl +L+p++l
CP002031_3 308 SESLNNSIHTIRRLCAGLHPSTL 330

CP002031_1264: domain 1 of 1, from 183 to 247: score 51.1, E = 7.3e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R++ +LHD +gQ+L+ +k+ ++ +r ++ +e ++ e+
CP002031_1 183 ERRRLSTDLHDLIGQTLAFAKIRAHSLREHV-----AEDGLTQWGEL 224

relarealaevRrllgdLRpaal<-*
+l++++++evR l+ ++ p++l
CP002031_1 225 TGLLDQSIQEVRSLIFQISPPIL 247

CP002031_0225: domain 1 of 1, from 553 to 620: score 30.5, E = 8.5e-09
*->RaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.earealdei
R+ +A ELHD++g L+a++l ++ l+ p++ +r++++
CP002031_0 553 RKKLAAELHDEIGRDLTALNLNFTVIGNLA--VQGPDgGLRARIEDT 597

relarealaevRrllgdLRpaal<-*
++l+++ + vR l LRp++l
CP002031_0 598 ERLIEDISRTVRGLTAKLRPPVL 620


Histogram of all scores:
score obs exp (one = represents 11 sequences)
----- --- ---
-14 26 0|===
-13 60 0|======
-12 101 37|===*======
-11 146 307|============== *
-10 447 714|========================================= *
-9 595 811|======================================================= *
-8 473 625|=========================================== *
-7 433 393|===================================*====
-6 308 222|====================*=======
-5 309 119|==========*==================
-4 154 62|=====*========
-3 116 32|==*========
-2 64 16|=*====
-1 45 8|*====
0 28 4|*==
1 13 2|*=
2 11 1|*
3 9 0|=
4 5 0|=
5 6 0|=
6 1 0|=
7 4 0|=
8 1 0|=
> 9 5 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1380.4919
P(chi-square) = 0

Total sequences searched: 3360

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: