Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

2 accessions found for Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111  

Data for CP002040  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP002040.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP002040_1945 CDS_2394666-2395847 87.5 1.9e-25 1
CP002040_3547 CDS_4313728-4314939 87.4 2.1e-25 1
CP002040_2059 CDS_2506518-2507687 82.4 6.4e-24 2
CP002040_4586 CDS_5528321-5527158 80.3 2.6e-23 1
CP002040_4788 CDS_5759931-5758783 79.6 4.1e-23 1
CP002040_1998 CDS_2446760-2445576 78.2 1.1e-22 1
CP002040_2741 CDS_3322985-3321711 76.1 4.7e-22 1
CP002040_4352 CDS_5254623-5255783 75.7 5.9e-22 2
CP002040_3952 CDS_4793980-4795554 75.6 6.2e-22 1
CP002040_2158 CDS_2616442-2617932 74.2 1.7e-21 1
CP002040_1935 CDS_2387360-2386026 71.8 8.4e-21 1
CP002040_4301 CDS_5199229-5200635 70.1 2.8e-20 1
CP002040_2064 CDS_2512403-2513803 68.7 7e-20 1
CP002040_2457 CDS_2955058-2953907 67.6 1.5e-19 1
CP002040_0342 CDS_423812-422484 64.1 1.6e-18 1
CP002040_0305 CDS_384919-386121 62.9 3.5e-18 1
CP002040_0304 CDS_384728-383511 60.9 1.4e-17 1
CP002040_1112 CDS_1380390-1381658 60.4 1.9e-17 1
CP002040_2103 CDS_2551592-2552893 59.2 4.3e-17 1
CP002040_3464 CDS_4223291-4224457 58.6 6.5e-17 1
CP002040_1784 CDS_2215794-2214625 57.1 1.8e-16 1
CP002040_1643 CDS_2038134-2036968 55.1 6.9e-16 1
CP002040_2400 CDS_2887258-2885873 54.1 1.4e-15 1
CP002040_0772 CDS_960936-962546 51.7 7.3e-15 1
CP002040_4189 CDS_5070763-5072457 33.2 2.1e-09 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP002040_1945 1/1 191 258 .. 1 70 [] 87.5 1.9e-25
CP002040_3547 1/1 183 250 .. 1 70 [] 87.4 2.1e-25
CP002040_2059 1/2 184 251 .. 1 70 [] 81.8 9.4e-24
CP002040_4586 1/1 184 250 .. 1 70 [] 80.3 2.6e-23
CP002040_4788 1/1 180 250 .. 1 70 [] 79.6 4.1e-23
CP002040_1998 1/1 184 252 .. 1 70 [] 78.2 1.1e-22
CP002040_2741 1/1 207 272 .. 1 70 [] 76.1 4.7e-22
CP002040_3952 1/1 215 282 .. 1 70 [] 75.6 6.2e-22
CP002040_4352 2/2 185 253 .. 1 70 [] 75.1 9.2e-22
CP002040_2158 1/1 293 360 .. 1 70 [] 74.2 1.7e-21
CP002040_1935 1/1 242 309 .. 1 70 [] 71.8 8.4e-21
CP002040_4301 1/1 238 305 .. 1 70 [] 70.1 2.8e-20
CP002040_2064 1/1 269 336 .. 1 70 [] 68.7 7e-20
CP002040_2457 1/1 174 241 .. 1 70 [] 67.6 1.5e-19
CP002040_0342 1/1 228 295 .. 1 70 [] 64.1 1.6e-18
CP002040_0305 1/1 199 265 .. 1 70 [] 62.9 3.5e-18
CP002040_0304 1/1 217 282 .. 1 70 [] 60.9 1.4e-17
CP002040_1112 1/1 196 272 .. 1 70 [] 60.4 1.9e-17
CP002040_2103 1/1 236 301 .. 1 70 [] 59.2 4.3e-17
CP002040_3464 1/1 198 263 .. 1 70 [] 58.6 6.5e-17
CP002040_1784 1/1 197 259 .. 1 64 [. 57.1 1.8e-16
CP002040_1643 1/1 196 263 .. 1 70 [] 55.1 6.9e-16
CP002040_2400 1/1 259 325 .. 1 70 [] 54.1 1.4e-15
CP002040_0772 1/1 197 263 .. 1 70 [] 51.7 7.3e-15
CP002040_4189 1/1 202 268 .. 1 70 [] 33.2 2.1e-09

Alignments of top-scoring domains:
CP002040_1945: domain 1 of 1, from 191 to 258: score 87.5, E = 1.9e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARE HD vg+sLs+i++q+++a++++ d+ pe+a al++i
CP002040_1 191 ERLRIAREVHDLVGHSLSVISMQASVALHVV--DRRPEQASVALAAI 235

relarealaevRrllgdLRpaal<-*
r+ +r al+e+R +l ++R +a+
CP002040_1 236 RDSSRSALEELRGTLAVFRGGAE 258

CP002040_3547: domain 1 of 1, from 183 to 250: score 87.4, E = 2.1e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+AR+ HD+v++++s+i++q+++a++l+ +++p++a+eal++i
CP002040_3 183 ERVRLARDVHDTVAHNISLINVQAGTALYLM--ETEPQRAAEALATI 227

relarealaevRrllgdLRpaal<-*
+++++++l e+R +lg+LR ++
CP002040_3 228 KQTSKDTLVELRGMLGVLRAVDE 250

CP002040_2059: domain 1 of 2, from 184 to 251: score 81.8, E = 9.4e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIAR+LHD+v+++L +i++ +++a++++ ++dp ear al+ i
CP002040_2 184 ERLRIARDLHDVVSHNLGLIAVRAGVAAHVA--EADPREARVALRDI 228

relarealaevRrllgdLRpaal<-*
+e++r al+e+Rr+lg+LR+ +
CP002040_2 229 EEASRSALTEMRRALGVLRTEQA 251

CP002040_4586: domain 1 of 1, from 184 to 250: score 80.3, E = 2.6e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD+v ++ +a+ +q+e ar+l+ ++p++++++l+++
CP002040_4 184 ERTRIARELHDVVTHHVTAMVVQAESARYLT---SAPDRLDQTLTAV 227

relarealaevRrllgdLRpaal<-*
+++r+a++++R+ll L p+
CP002040_4 228 TDTGRRAITDLRHLLDLLNPDHS 250

CP002040_4788: domain 1 of 1, from 180 to 250: score 79.6, E = 4.1e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe...eareal
ER+RIAR+LHD vg++Ls+++l++++a+ +l d+dp++ + ar++l
CP002040_4 180 ERTRIARDLHDAVGHHLSVVSLHAGVAAEAL--DDDPAdvpVARAEL 224

deirelarealaevRrllgdLRpaal<-*
d +++++r +l+e+R+++++LR+a+
CP002040_4 225 DHVARASRAGLSELRATVRALREADP 250

CP002040_1998: domain 1 of 1, from 184 to 252: score 78.2, E = 1.1e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD+++++Ls+++ +++++++ d++pe++++a+ +
CP002040_1 184 ERTRIAREMHDVLAHRLSLLATYAGALEYRP--DAPPEQLARAAGVV 228

relarealaevRrllgdLR.paal<-*
r+ +++al+e+R+++g+LR++ +
CP002040_1 229 RTGVHQALEELREVIGVLReEEPE 252

CP002040_2741: domain 1 of 1, from 207 to 272: score 76.1, E = 4.7e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD+v+++ s++ l++++++ + +++ + ea+ i
CP002040_2 207 ERTRIAREMHDVVAHRVSLMVLHAGGLEVSA--EDP--RTVEAAGLI 249

relarealaevRrllgdLRpaal<-*
r+++real+e+R +lg+LR++++
CP002040_2 250 RTTGREALTELRGILGVLRDDTD 272

CP002040_3952: domain 1 of 1, from 215 to 282: score 75.6, E = 6.2e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD +++sL +i q+++ r+++ +++pe+a +al+++
CP002040_3 215 ERTRIAREMHDILAHSLNVIVAQADGGRYAA--KAAPERAVAALATV 259

relarealaevRrllgdLRpaal<-*
++ +re+ ae+ +llg+LR++++
CP002040_3 260 AQVGRESAAELHQLLGVLRDGEE 282

CP002040_4352: domain 2 of 2, from 185 to 253: score 75.1, E = 9.2e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+ +ARE+HD++g++Ls++++++++++++ d+++ee+++ ++ i
CP002040_4 185 VREAMAREIHDVLGHRLSLLSVHAGALEYRP--DAPAEEVARSAKVI 229

relarealaevRrllgdLR.paal<-*
re a++al+++R+++g+LR p ++
CP002040_4 230 RESAHQALQDLREVIGVLRaPVGE 253

CP002040_2158: domain 1 of 1, from 293 to 360: score 74.2, E = 1.7e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARELHDs+g++Ls+++lq+ +a+rll d+dp+ ar+al+ i
CP002040_2 293 ERNRLARELHDSLGHALSVVTLQAATAARLL--DTDPDFARQALTHI 337

relarealaevRrllgdLRpaal<-*
++ ar+a a++ ++lg LR+ +
CP002040_2 338 ADQARTATADLDHALGILRENTP 360

CP002040_1935: domain 1 of 1, from 242 to 309: score 71.8, E = 8.4e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R+LHD+ +L a+ + l++a++++ dkdpe ar+ l+e+
CP002040_1 242 EIRRIERDLHDGAQARLVALGMNLGMAEQIV--DKDPETARAMLTEA 286

relarealaevRrllgdLRpaal<-*
re+ r+al+e+R+l+++++p++l
CP002040_1 287 RETTRHALTELRDLVRGIHPPVL 309

CP002040_4301: domain 1 of 1, from 238 to 305: score 70.1, E = 2.8e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR++RE+HDs g+ L+a+++ l+ a+r ++ p+ a e+++++
CP002040_4 238 ERARMSREMHDSTGHYLTALTMSLSNALRFR--TARPDSAWEEVRQA 282

relarealaevRrllgdLRpaal<-*
relareal+++Rr +++LRp +l
CP002040_4 283 RELAREALTDTRRWVRALRPLGL 305

CP002040_2064: domain 1 of 1, from 269 to 336: score 68.7, E = 7e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHD+ Q+L a+++ l +ar ++ ++dp+ a e ++e+
CP002040_2 269 ERRRIERDLHDGAQQRLLALTMTLTRARSRV--ATDPDTALELITEA 313

relarealaevRrllgdLRpaal<-*
++ +re ++e+R+++++L+p +l
CP002040_2 314 QRESREVMDELRQVARGLHPRVL 336

CP002040_2457: domain 1 of 1, from 174 to 241: score 67.6, E = 1.5e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARE+HD+++++L++i+l ++++ ++ d +++ ++ ++ei
CP002040_2 174 ERDRIAREMHDVLAHRLTLISLNASALTHRP--DLAAADRDALAEEI 218

relarealaevRrllgdLRpaal<-*
+ r++laevR +l+dLR +++
CP002040_2 219 LTNTRQSLAEVRGILSDLRSGQD 241

CP002040_0342: domain 1 of 1, from 228 to 295: score 64.1, E = 1.6e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARE HD+++Q++++i +++++ + d+dpe ar++l+ +
CP002040_0 228 ERERLAREVHDTLAQGFTSIVALTQAVESEM--DSDPELARRHLALM 272

relarealaevRrllgdLRpaal<-*
re+a e lae+R+++ + +p +l
CP002040_0 273 RETAAENLAEARAMVAARQPVGL 295

CP002040_0305: domain 1 of 1, from 199 to 265: score 62.9, E = 3.5e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R ARE HD+v+++L a+ + +++ar+ d+e +r+al+ i
CP002040_0 199 ERLRVAREVHDVVSHTLGAVGMRAGVARYTG---GDAEDLRAALADI 242

relarealaevRrllgdLRpaal<-*
++++r+a +e+Rr+l LR + +
CP002040_0 243 EAASRQASDELRRVLVSLRGDHD 265

CP002040_0304: domain 1 of 1, from 217 to 282: score 60.9, E = 1.4e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R+LHD+ +L ai++ql++ar ++ + + ++++ l+++
CP002040_0 217 ELRRIERDLHDGTQARLVAIAMQLGVAREAV--ENP--AVAALLRNA 259

relarealaevRrllgdLRpaal<-*
+e a+ea+ae+R++++++ p++l
CP002040_0 260 HEGAEEAMAELREVIQGIYPPIL 282

CP002040_1112: domain 1 of 1, from 196 to 272: score 60.4, E = 1.9e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.........
ER+RIARE+HD+v++++s+++++++++++++ +++ ++ ++ ++
CP002040_1 196 ERQRIAREMHDVVAHRMSLLSVHAGALAYRT--ERAERgeapplena 240

earealdeirelarealaevRrllgdLRpaal<-*
e+ +a++ ir+ a++al+e+ +l++LR a+
CP002040_1 241 ELGAAVRVIRDNAHQALEELGGVLSVLRAADT 272

CP002040_2103: domain 1 of 1, from 236 to 301: score 59.2, E = 4.3e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHD+v Q+ a+++ l++a+r dpe+a++ ++++
CP002040_2 236 ERRRIERDLHDGVQQRVVALAMLLGRAQR----GHDPERAARLVRQA 278

relarealaevRrllgdLRpaal<-*
++ r l+e+R+++++ p+al
CP002040_2 279 HTETRVLLDELREVAWRVYPTAL 301

CP002040_3464: domain 1 of 1, from 198 to 263: score 58.6, E = 6.5e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHD+v Q+L ++ + l++arr d e+ r+ ++++
CP002040_3 198 ERRRIERDLHDGVQQRLVLLGMALGRARR----DPGSERGRALVEQA 240

relarealaevRrllgdLRpaal<-*
e +r+al+++ +++++ paal
CP002040_3 241 YEESRDALRDLKEVAWRVYPAAL 263

CP002040_1784: domain 1 of 1, from 197 to 259: score 57.1, E = 1.8e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RI+R+LHD+ g +L+ai+++++la l++ + + e+a++++ +i
CP002040_1 197 ERLRISRDLHDVFGRTLAAIAVKSSLASELVQ-RGHGERAATEISAI 242

relarealaevRrllgd<-*
r+la+ea +evRr++++
CP002040_1 243 RGLAEEAGTEVRRVVRG 259

CP002040_1643: domain 1 of 1, from 196 to 263: score 55.1, E = 6.9e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R A +LHD g++L ++kl++ lar+l+ ++dp++a+e+l ei
CP002040_1 196 ERMRFASDLHDIQGHTLHVVKLKTALARKLV--RADPDRAEEELGEI 240

relarealaevRrllgdLRpaal<-*
++l+ ++++++R+l+++ R l
CP002040_1 241 QALVGDTITQTRELAHAQRRLNL 263

CP002040_2400: domain 1 of 1, from 259 to 325: score 54.1, E = 1.4e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
ER+RI R+LHD+ Q+L a+++ l++ar + e++ea++++
CP002040_2 259 ERRRIERDLHDGAQQRLVALSVDLGVAR-----LDLEEgsEADQRVV 300

eirelarealaevRrllgdLRpaal<-*
++++ a+e ++e+R+l+++++p +l
CP002040_2 301 AAQAKADELITELRELVRGIHPRVL 325

CP002040_0772: domain 1 of 1, from 197 to 263: score 51.7, E = 7.3e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIA+++HDs+g+ Ls+i+l +++++ + ++ ++e r+ + e+
CP002040_0 197 ERSRIAQDMHDSLGHELSLIALRAGALE-VS--PDLDQEHRRSASEL 240

relarealaevRrllgdLRpaal<-*
r +a ea + +R+++g+LR +++
CP002040_0 241 RITAVEATRSLREIIGVLRADTE 263

CP002040_4189: domain 1 of 1, from 202 to 268: score 33.2, E = 2.1e-09
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIA +HDs+g+ L++i++ + ++++ + +d e+ r a+ e+
CP002040_4 202 ERARIATRMHDSLGHDLALIAVRAAALEMTA--LEDSEQGR-AAGEL 245

relarealaevRrllgdLRpaal<-*
r++a+ea +R+++g+LR+++
CP002040_4 246 RTAAHEANLRLREIIGVLREDDG 268


Histogram of all scores:
score obs exp (one = represents 12 sequences)
----- --- ---
-14 4 0|=
-13 38 0|====
-12 64 53|====*=
-11 100 439|========= *
-10 355 1020|============================== *
-9 651 1158|======================================================= *
-8 671 892|======================================================== *
-7 677 561|==============================================*==========
-6 622 317|==========================*=========================
-5 677 170|==============*==========================================
-4 324 88|=======*===================
-3 228 45|===*===============
-2 128 23|=*=========
-1 99 11|*========
0 60 6|*====
1 28 3|*==
2 17 1|*=
3 10 0|=
4 6 0|=
5 7 0|=
6 1 0|=
7 1 0|=
> 8 30 -|===


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 5730.0513
P(chi-square) = 0

Total sequences searched: 4798

Whole sequence top hits:
tophits_s report:
Total hits: 25
Satisfying E cutoff: 25
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 25
Satisfying E cutoff: 25
Total memory: 29K


Acknowledgements:

This research is funded by:

Developed by: