Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

2 accessions found for   

Data for CP002041  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP002041.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP002041_0608 CDS_674686-675900 89.9 5.7e-27 1
CP002041_0053 CDS_54525-55763 86.8 4.7e-26 1
CP002041_0005 CDS_5575-4319 83.0 6.2e-25 1
CP002041_0607 CDS_673385-674689 43.8 2.1e-13 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP002041_0608 1/1 209 276 .. 1 70 [] 89.9 5.7e-27
CP002041_0053 1/1 213 279 .. 1 70 [] 86.8 4.7e-26
CP002041_0005 1/1 204 271 .. 1 70 [] 83.0 6.2e-25
CP002041_0607 1/1 228 295 .. 1 70 [] 43.8 2.1e-13

Alignments of top-scoring domains:
CP002041_0608: domain 1 of 1, from 209 to 276: score 89.9, E = 5.7e-27
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R AR++HD +g+sLsa++++++la rl+ ++dpe+a ++++e+
CP002041_0 209 ERLRFARDMHDLLGHSLSALAVKAQLAGRLV--ERDPERAGAEMAEV 253

relarealaevRrllgdLRpaal<-*
+ lar+al++vR +++++R+ +l
CP002041_0 254 QVLARQALQQVRSAVSGYREVDL 276

CP002041_0053: domain 1 of 1, from 213 to 279: score 86.8, E = 4.7e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARE+HD+++Q+L++i q+++a+r+ +dp++ar ++d++
CP002041_0 213 ERQRMAREIHDTLAQGLAGIVTQIQAAQRVW---EDPGAARPHADRA 256

relarealaevRrllgdLRpaal<-*
+lare+lae+Rr +++LRp++l
CP002041_0 257 LGLARESLAEARRSVQALRPGQL 279

CP002041_0005: domain 1 of 1, from 204 to 271: score 83.0, E = 6.2e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER IAR+LHD+v++ ++i +q++++r+++ d+dp+++r al ei
CP002041_0 204 ERLAIARDLHDVVAHEVTGIVVQAQALRHIA--DRDPGAVRNALPEI 248

relarealaevRrllgdLRpaal<-*
++++ +al+ +R ++++LR++++
CP002041_0 249 EAAGARALESMRGMVSRLREPGD 271

CP002041_0607: domain 1 of 1, from 228 to 295: score 43.8, E = 2.1e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R A+++ ++gQ+L+ +++ + +a+ ll +dp+ +++++e+
CP002041_0 228 ERLRFAQDMQGVIGQGLTTLAVRARRAELLL--GSDPAGSAAEIEEV 272

relarealaevRrllgdLRpaal<-*
+elar+ l++vR +++++R +l
CP002041_0 273 HELARRVLQQVRSAVSGYRGVDL 295


Histogram of all scores:
score obs exp (one = represents 2 sequences)
----- --- ---
-14 2 0|=
-13 13 0|=======
-12 17 7|===*=====
-11 29 64|=============== *
-10 63 148|================================ *
-9 98 168|================================================= *
-8 94 130|=============================================== *
-7 95 81|========================================*=======
-6 91 46|======================*=======================
-5 82 24|===========*=============================
-4 32 12|=====*==========
-3 25 6|==*==========
-2 21 3|=*=========
-1 18 1|*========
0 4 0|==
1 2 0|=
2 1 0|=
3 2 0|=
4 1 0|=
5 1 0|=
6 1 0|=
7 0 0|
8 1 0|=
9 0 0|
> 10 6 -|===


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 374.4401
P(chi-square) = 0

Total sequences searched: 699

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: