Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
7 projects found  

3 accessions found for Meiothermus silvanus DSM 9946  

Data for CP002042  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP002042.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP002042_2602 CDS_2747123-2745465 87.3 1.5e-25 1
CP002042_2743 CDS_2906095-2908143 82.0 5.5e-24 1
CP002042_1007 CDS_1040796-1042268 74.1 1.2e-21 2
CP002042_0063 CDS_63287-64477 65.0 5.5e-19 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP002042_2602 1/1 355 422 .. 1 70 [] 87.3 1.5e-25
CP002042_2743 1/1 481 548 .. 1 70 [] 82.0 5.5e-24
CP002042_0063 1/1 196 260 .. 1 70 [] 65.0 5.5e-19
CP002042_1007 1/2 225 255 .. 1 31 [. 46.1 2e-13

Alignments of top-scoring domains:
CP002042_2602: domain 1 of 1, from 355 to 422: score 87.3, E = 1.5e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD+++Q+L+ ++l+l+la+rll d+d +a ++++++
CP002042_2 355 ERNRIAREIHDGIAQALAFMALKLDLAERLL--DTDRKRALAEMAQV 399

relarealaevRrllgdLRpaal<-*
re++r ++evRr + +LRp +l
CP002042_2 400 RETLRAQIREVRRSIFALRPIDL 422

CP002042_2743: domain 1 of 1, from 481 to 548: score 82.0, E = 5.5e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARELHDsv+Q+L +i+l++ +a+ ++ +++p++++e l+ +
CP002042_2 481 ERQRLARELHDSVSQALYGIALGARAAQNAA--ERNPQALKEPLEYV 525

relarealaevRrllgdLRpaal<-*
+la+ ++ae+R+l+ +LRp l
CP002042_2 526 LALAEAGIAEMRALIFELRPESL 548

CP002042_0063: domain 1 of 1, from 196 to 260: score 65.0, E = 5.5e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+ARE+HDsv+Q L+a+ l l +ar + ++e+ ++al++
CP002042_0 196 ERARLAREMHDSVAQLLFAADLSLRVAR-----EGPNEQRETALERS 237

relarealaevRrllgdLRpaal<-*
+ l+ al+e+R l+ LRpa+l
CP002042_0 238 ALLVGSALDELRGLVELLRPADL 260

CP002042_1007: domain 1 of 2, from 225 to 255: score 46.1, E = 2e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrll<-*
ER+R+ARE+HD+++Q++++i ++le+a++++
CP002042_1 225 ERQRLAREIHDTLAQNFTSIVMHLEAAEAAI 255


Histogram of all scores:
score obs exp (one = represents 9 sequences)
----- --- ---
-14 1 0|=
-13 34 0|====
-12 54 34|===*==
-11 94 281|=========== *
-10 330 653|===================================== *
-9 499 741|======================================================== *
-8 416 571|=============================================== *
-7 411 359|=======================================*======
-6 422 203|======================*========================
-5 306 109|============*=====================
-4 158 56|======*===========
-3 115 29|===*=========
-2 68 14|=*======
-1 78 7|*========
0 28 3|*===
1 23 1|*==
2 14 0|==
3 3 0|=
4 7 0|=
5 3 0|=
6 2 0|=
7 0 0|
8 1 0|=
> 9 5 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 2283.1328
P(chi-square) = 0

Total sequences searched: 3072

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: