Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Arcanobacterium haemolyticum DSM 20595  

Data for CP002045  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP002045.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP002045_0402 CDS_484540-483350 93.6 1.1e-27 1
CP002045_1522 CDS_1735883-1736962 81.5 4.3e-24 1
CP002045_1023 CDS_1215664-1217298 47.0 6.2e-14 1
CP002045_0505 CDS_612413-611685 30.2 5.5e-09 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP002045_0402 1/1 186 254 .. 1 70 [] 93.6 1.1e-27
CP002045_1522 1/1 177 244 .. 1 70 [] 81.5 4.3e-24
CP002045_1023 1/1 336 405 .. 1 70 [] 47.0 6.2e-14
CP002045_0505 1/1 33 105 .. 1 70 [] 30.2 5.5e-09

Alignments of top-scoring domains:
CP002045_0402: domain 1 of 1, from 186 to 254: score 93.6, E = 1.1e-27
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIAR+LHD v+++L +++ q+++ r++ +kdpe+a +ald+i
CP002045_0 186 ERTRIARDLHDIVAHTLGVVIAQADGGRYAG--RKDPEQALRALDTI 230

relarealaevRrllgdLR.paal<-*
+++r al+++R ++g+LR+p+++
CP002045_0 231 SDMSRAALSDIRSIVGVLRePSDF 254

CP002045_1522: domain 1 of 1, from 177 to 244: score 81.5, E = 4.3e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+AR+ HD++g+sL+ ++l++ela+r++ d+dp++ar +l++i
CP002045_1 177 ERDRLARDVHDVLGHSLTILALKSELALRVF--DSDPQRARSELEAI 221

relarealaevRrllgdLRpaal<-*
l r a+aevR+++++LR + l
CP002045_1 222 SSLTRSAIAEVRATVSGLRMQLL 244

CP002045_1023: domain 1 of 1, from 336 to 405: score 47.0, E = 6.2e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.....eare
ER RI R+LHD Q+L+a +++ +++ ++ ++++ e+ +
CP002045_1 336 ERSRIGRDLHDLAIQQLFASGMHITAVK-----EDLAAkgyavEVGT 377

aldeirelarealaevRrllgdLRpaal<-*
ald++ ++e+ +++R +++ LR++
CP002045_1 378 ALDQAISSIDESVRQIRVIVQSLRDDSA 405

CP002045_0505: domain 1 of 1, from 33 to 105: score 30.2, E = 5.5e-09
*->ERaRIARELHDsvgQsLsaiklqlelarrllds.dkdpe...earea
ER+RI R+LHD+ Q + a + l+ + ++ ++ p++ + +
CP002045_0 33 ERRRIERDLHDGAQQYIVATGMALGEMELVV-AmADLPAelaDLPAI 78

ldeirelarealaevRrllgdLRpaal<-*
+ +++ + +++la +R+++ + +p +l
CP002045_0 79 ISRAQSANERGLASLRETVNNVHPKIL 105


Histogram of all scores:
score obs exp (one = represents 6 sequences)
----- --- ---
-14 9 0|==
-13 20 0|====
-12 44 19|===*====
-11 97 158|================= *
-10 226 368|====================================== *
-9 332 418|======================================================== *
-8 248 322|========================================== *
-7 251 202|=================================*========
-6 188 114|==================*=============
-5 143 61|==========*=============
-4 60 32|=====*====
-3 38 16|==*====
-2 21 8|=*==
-1 15 4|*==
0 14 2|*==
1 11 1|*=
2 4 0|=
3 1 0|=
4 1 0|=
5 0 0|
6 1 0|=
7 0 0|
8 1 0|=
9 0 0|
> 10 6 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 382.6433
P(chi-square) = 0

Total sequences searched: 1731

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: