Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Streptomyces bingchenggensis BCW-1  

Data for CP002047  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP002047.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP002047_5936 CDS_7217800-7219044 100.2 7.6e-29 1
CP002047_9278 CDS_11056031-11057347 97.2 5.8e-28 1
CP002047_7463 CDS_8878003-8879457 95.2 2.2e-27 1
CP002047_3419 CDS_4454919-4453777 94.1 4.7e-27 1
CP002047_7802 CDS_9251302-9252603 86.4 8.9e-25 1
CP002047_5572 CDS_6815992-6817173 86.3 9.3e-25 1
CP002047_6238 CDS_7542459-7543640 85.9 1.2e-24 1
CP002047_8119 CDS_9610834-9609497 84.8 2.5e-24 1
CP002047_4344 CDS_5467804-5466371 84.8 2.7e-24 1
CP002047_2255 CDS_3071331-3070159 84.6 2.9e-24 1
CP002047_4387 CDS_5515445-5516740 83.7 5.6e-24 1
CP002047_3055 CDS_3990258-3991193 83.7 5.6e-24 1
CP002047_4468 CDS_5602589-5603845 83.3 7.2e-24 2
CP002047_5157 CDS_6354938-6353826 81.8 2e-23 1
CP002047_6765 CDS_8104421-8105716 81.6 2.3e-23 1
CP002047_0615 CDS_783887-782466 81.6 2.3e-23 1
CP002047_8190 CDS_9688271-9689317 79.1 1.3e-22 1
CP002047_7615 CDS_9038629-9037379 79.0 1.3e-22 1
CP002047_7242 CDS_8657276-8658475 78.4 2e-22 1
CP002047_2217 CDS_3015903-3017150 77.2 4.6e-22 1
CP002047_6838 CDS_8190914-8189658 76.5 7.1e-22 1
CP002047_5185 CDS_6387553-6388749 74.5 2.7e-21 1
CP002047_4819 CDS_5993878-5995080 74.5 2.9e-21 1
CP002047_6810 CDS_8161217-8162500 74.3 3.2e-21 1
CP002047_0838 CDS_1234200-1232845 74.1 3.6e-21 1
CP002047_1648 CDS_2220569-2221804 73.8 4.5e-21 1
CP002047_4995 CDS_6179978-6182116 73.4 5.8e-21 2
CP002047_0410 CDS_484401-483271 72.0 1.5e-20 1
CP002047_1021 CDS_1476784-1478124 71.8 1.7e-20 1
CP002047_7485 CDS_8904301-8905470 71.6 2.1e-20 1
CP002047_7758 CDS_9202282-9200999 71.2 2.7e-20 1
CP002047_5584 CDS_6827701-6826277 71.0 3e-20 1
CP002047_4813 CDS_5985066-5986295 71.0 3.1e-20 1
CP002047_6768 CDS_8108340-8107024 70.9 3.3e-20 1
CP002047_5875 CDS_7150518-7148884 70.9 3.3e-20 1
CP002047_5904 CDS_7183094-7184404 70.1 5.7e-20 1
CP002047_3825 CDS_4919982-4918792 68.4 1.7e-19 1
CP002047_5719 CDS_6963634-6962315 68.3 1.9e-19 1
CP002047_7177 CDS_8591558-8592943 68.0 2.3e-19 1
CP002047_5519 CDS_6754000-6755181 67.2 4e-19 1
CP002047_9681 CDS_11558677-11559864 65.3 1.5e-18 1
CP002047_8842 CDS_10484453-10483113 60.2 4.5e-17 1
CP002047_2966 CDS_3873850-3872669 59.9 5.7e-17 2
CP002047_4857 CDS_6035913-6034660 57.9 2.2e-16 1
CP002047_3772 CDS_4853254-4854507 56.9 4.3e-16 1
CP002047_3680 CDS_4753438-4755045 55.7 9.9e-16 1
CP002047_6128 CDS_7438678-7437338 55.1 1.4e-15 1
CP002047_9295 CDS_11076123-11074375 54.7 1.9e-15 1
CP002047_6129 CDS_7440038-7438866 53.9 3.4e-15 1
CP002047_7233 CDS_8649185-8650498 52.8 7.1e-15 1
CP002047_3479 CDS_4525706-4523565 49.2 8.1e-14 1
CP002047_5879 CDS_7154849-7152759 45.6 9.1e-13 1
CP002047_9094 CDS_10790874-10792589 37.6 2.1e-10 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP002047_5936 1/1 199 266 .. 1 70 [] 100.2 7.6e-29
CP002047_9278 1/1 205 273 .. 1 70 [] 97.2 5.8e-28
CP002047_7463 1/1 227 294 .. 1 70 [] 95.2 2.2e-27
CP002047_3419 1/1 176 243 .. 1 70 [] 94.1 4.7e-27
CP002047_7802 1/1 209 276 .. 1 70 [] 86.4 8.9e-25
CP002047_5572 1/1 178 245 .. 1 70 [] 86.3 9.3e-25
CP002047_6238 1/1 190 257 .. 1 70 [] 85.9 1.2e-24
CP002047_8119 1/1 220 286 .. 2 70 .] 84.8 2.5e-24
CP002047_4344 1/1 185 253 .. 1 70 [] 84.8 2.7e-24
CP002047_2255 1/1 183 250 .. 1 70 [] 84.6 2.9e-24
CP002047_4387 1/1 196 263 .. 1 70 [] 83.7 5.6e-24
CP002047_3055 1/1 198 266 .. 1 70 [] 83.7 5.6e-24
CP002047_4468 1/2 206 273 .. 1 70 [] 82.1 1.6e-23
CP002047_5157 1/1 164 232 .. 1 70 [] 81.8 2e-23
CP002047_6765 1/1 212 280 .. 1 70 [] 81.6 2.3e-23
CP002047_0615 1/1 216 283 .. 1 70 [] 81.6 2.3e-23
CP002047_8190 1/1 150 217 .. 1 70 [] 79.1 1.3e-22
CP002047_7615 1/1 187 254 .. 1 70 [] 79.0 1.3e-22
CP002047_7242 1/1 209 276 .. 1 70 [] 78.4 2e-22
CP002047_2217 1/1 192 259 .. 1 70 [] 77.2 4.6e-22
CP002047_6838 1/1 200 267 .. 1 70 [] 76.5 7.1e-22
CP002047_5185 1/1 195 262 .. 1 70 [] 74.5 2.7e-21
CP002047_4819 1/1 165 230 .. 1 70 [] 74.5 2.9e-21
CP002047_6810 1/1 225 290 .. 1 70 [] 74.3 3.2e-21
CP002047_0838 1/1 229 296 .. 1 70 [] 74.1 3.6e-21
CP002047_1648 1/1 208 275 .. 1 70 [] 73.8 4.5e-21
CP002047_0410 1/1 171 237 .. 1 70 [] 72.0 1.5e-20
CP002047_1021 1/1 170 235 .. 1 70 [] 71.8 1.7e-20
CP002047_7485 1/1 197 262 .. 1 70 [] 71.6 2.1e-20
CP002047_7758 1/1 228 295 .. 1 70 [] 71.2 2.7e-20
CP002047_5584 1/1 255 323 .. 1 70 [] 71.0 3e-20
CP002047_4813 1/1 201 261 .. 1 63 [. 71.0 3.1e-20
CP002047_6768 1/1 240 307 .. 1 70 [] 70.9 3.3e-20
CP002047_5875 1/1 331 414 .. 1 70 [] 70.9 3.3e-20
CP002047_5904 1/1 235 300 .. 1 70 [] 70.1 5.7e-20
CP002047_3825 1/1 198 258 .. 1 63 [. 68.4 1.7e-19
CP002047_5719 1/1 211 278 .. 1 70 [] 68.3 1.9e-19
CP002047_7177 1/1 193 265 .. 1 70 [] 68.0 2.3e-19
CP002047_5519 1/1 204 270 .. 1 70 [] 67.2 4e-19
CP002047_9681 1/1 199 259 .. 1 63 [. 65.3 1.5e-18
CP002047_8842 1/1 234 299 .. 1 70 [] 60.2 4.5e-17
CP002047_2966 1/2 182 247 .. 1 70 [] 59.9 5.7e-17
CP002047_4857 1/1 225 292 .. 1 70 [] 57.9 2.2e-16
CP002047_3772 1/1 191 256 .. 1 70 [] 56.9 4.3e-16
CP002047_3680 1/1 184 250 .. 1 70 [] 55.7 9.9e-16
CP002047_6128 1/1 256 323 .. 1 70 [] 55.1 1.4e-15
CP002047_9295 1/1 375 440 .. 1 70 [] 54.7 1.9e-15
CP002047_6129 1/1 203 270 .. 1 70 [] 53.9 3.4e-15
CP002047_7233 1/1 224 291 .. 1 70 [] 52.8 7.1e-15
CP002047_3479 1/1 472 538 .. 1 70 [] 49.2 8.1e-14
CP002047_4995 2/2 498 562 .. 1 70 [] 45.6 9e-13
CP002047_5879 1/1 420 485 .. 1 70 [] 45.6 9.1e-13
CP002047_9094 1/1 373 438 .. 1 70 [] 37.6 2.1e-10

Alignments of top-scoring domains:
CP002047_5936: domain 1 of 1, from 199 to 266: score 100.2, E = 7.6e-29
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARELHD+v+++ s++ +q+++a++++ d++p++ar+al++i
CP002047_5 199 ERARIARELHDVVAHNVSVMVVQADGAAYVM--DAAPDQARQALETI 243

relarealaevRrllgdLRpaal<-*
+++r+alae+Rrllg+LR +a
CP002047_5 244 SGTGRQALAEMRRLLGVLRSGAP 266

CP002047_9278: domain 1 of 1, from 205 to 273: score 97.2, E = 5.8e-28
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD++++s+s+i++q+++ ++ll d dpe+ar+al++i
CP002047_9 205 ERLRIARELHDVLAHSISVINVQAGVGLALL--DQDPEQARTALTTI 249

relarealaevRrllgdLR.paal<-*
+++++eal evR++l +LR p+a
CP002047_9 250 KAASKEALGEVRQVLDTLRaPGAA 273

CP002047_7463: domain 1 of 1, from 227 to 294: score 95.2, E = 2.2e-27
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARELHD+v++++s+i++q++ a +++ p+ea++++ +i
CP002047_7 227 ERARIARELHDVVAHHMSVITVQADSAPYRI--GGLPPEAEREFGTI 271

relarealaevRrllgdLRpaal<-*
+++are+lae+Rrllg+LR +
CP002047_7 272 AATARESLAEMRRLLGVLRSEDA 294

CP002047_3419: domain 1 of 1, from 176 to 243: score 94.1, E = 4.7e-27
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIAR+LHD+vg+++s+i++q+ +a++++ +kdp +ar+al++i
CP002047_3 176 ERLRIARDLHDVVGHHISLISVQSTAALHRI--EKDPTQARTALAAI 220

relarealaevRrllgdLRpaal<-*
+ +real+e+R++lg+LR ++
CP002047_3 221 KSSSREALRELRATLGVLRQVDE 243

CP002047_7802: domain 1 of 1, from 209 to 276: score 86.4, E = 8.9e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+v+++++++++q+++a +++ d p++a++al+ +
CP002047_7 209 ERLRIARELHDVVAHHIALVNVQAGVASHVM--DNRPDQAKQALAHV 253

relarealaevRrllgdLRpaal<-*
r+++r al+e+R+++g LR ++
CP002047_7 254 RQASRSALDELRATVGLLRQYGD 276

CP002047_5572: domain 1 of 1, from 178 to 245: score 86.3, E = 9.3e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARELHD+v++++s +++q+e+ar + + p+ +e+l +i
CP002047_5 178 ERARIARELHDVVAHHISTLSVQAETARLTT--PGLPPLGAERLLAI 222

relarealaevRrllgdLRpaal<-*
++ar+al+e+Rrllg+LR++a
CP002047_5 223 GDTARQALTEMRRLLGVLRDDAS 245

CP002047_6238: domain 1 of 1, from 190 to 257: score 85.9, E = 1.2e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+v+++L++++ q+++a +l+ ++dp++a++ l+ +
CP002047_6 190 ERMRIARELHDVVAHHLALANAQAGTAGHLA--RTDPDQAQKILTDL 234

relarealaevRrllgdLRpaal<-*
+++ + al+e+ +++g LR +++
CP002047_6 235 AGTTSSALRELKATVGLLRQPDD 257

CP002047_8119: domain 1 of 1, from 220 to 286: score 84.8, E = 2.5e-24
*->RaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdeir
R+R+ARELHDsvg++Lsa++lq+++ar++l d+dpe ar+al++i+
CP002047_8 220 RNRLARELHDSVGHALSAVTLQAGAARKVL--DADPEFARQALAAIE 264

elarealaevRrllgdLRpaal<-*
e+ r+a e+ +lg LR+ ++
CP002047_8 265 ETTRDAVGELDSVLGLLRENDE 286

CP002047_4344: domain 1 of 1, from 185 to 253: score 84.8, E = 2.7e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD+v+++ s++ +++ ++++++ kdpe+a++ ++ +
CP002047_4 185 ERTRIAREMHDVVAHRVSLMVVHAAALQAVA--LKDPEKAAKNAALV 229

relarealaevRrllgdLR.paal<-*
+++r+al+e+R++lg+LR++++
CP002047_4 230 GDMGRQALTELRQMLGVLRsEDVG 253

CP002047_2255: domain 1 of 1, from 183 to 250: score 84.6, E = 2.9e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIAR++HD++++s+s++ +q+e+ +l d++p++a++a+ +i
CP002047_2 183 ERARIARDMHDVLAHSISLMVVQAEAGPVVL--DTAPARAAAAFGAI 227

relarealaevRrllgdLRpaal<-*
++++real+++Rr+l +LR+ +
CP002047_2 228 AGTGREALDQLRRMLAVLRDEEG 250

CP002047_4387: domain 1 of 1, from 196 to 263: score 83.7, E = 5.6e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARE+HD+v++s+ i+lq+++a+r++ ++ p++area+ ++
CP002047_4 196 ERLRIAREMHDTVAHSIGIIALQAGAAARVI--ETQPDKAREAMIAV 240

relarealaevRrllgdLRpaal<-*
++++re+l+ +Rr+lg+LR a+
CP002047_4 241 EKTGRETLSGLRRMLGALRQADR 263

CP002047_3055: domain 1 of 1, from 198 to 266: score 83.7, E = 5.6e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+RIARE+HD+++++Ls+++++++++++++ d+ p+e++ea+ i
CP002047_3 198 TRERIAREMHDVLAHRLSLLSVHAGALEYRA--DASPQEVAEAAGVI 242

relarealaevRrllgdLR.paal<-*
r a++al+++R+++g+LR p+ +
CP002047_3 243 RSSAHQALQDLREVIGVLRaPDSD 266

CP002047_4468: domain 1 of 2, from 206 to 273: score 82.1, E = 1.6e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD +g++Ls+i+ +++ +++ +k+pe+a +al++i
CP002047_4 206 ERTRIAREMHDIIGHHLSVITGLADGGSYAA--RKNPERATQALEAI 250

relarealaevRrllgdLRpaal<-*
+++real e+R llg LR+a+
CP002047_4 251 GDTSREALGELRKLLGMLRDATA 273

CP002047_5157: domain 1 of 1, from 164 to 232: score 81.8, E = 2e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARE+HD++++s +++ +q+e+ ++ +++p++a++a+d+i
CP002047_5 164 ERARIAREMHDVLSHSVALMVVQAEAGPVAV--RTAPDRAEAAFDAI 208

relarealaevRrllgdLR.paal<-*
e++r+a+ ++Rr+lg+LR++a++
CP002047_5 209 SETGRDAMVQLRRMLGVLReDATD 232

CP002047_6765: domain 1 of 1, from 212 to 280: score 81.6, E = 2.3e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD v++s+ +i++q+++ r+l d+ pe+ar++ld+i
CP002047_6 212 ERLRIARELHDMVAHSIGVIAIQAGAGSRVL--DSRPEQARATLDAI 256

relarealaevRrllgdLR.paal<-*
++++re+l +R++l +LR++ +
CP002047_6 257 ETTSRETLHGLRNMLDVLRrTEPE 280

CP002047_0615: domain 1 of 1, from 216 to 283: score 81.6, E = 2.3e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD v++++++++ q+ +a++l+ d+ pe+ r+ l+e+
CP002047_0 216 ERVRIARELHDLVAHQITLANAQATVAAHLF--DARPEQTRKSLKEL 260

relarealaevRrllgdLRpaal<-*
e+ +al+e+R+++g LR +++
CP002047_0 261 VETTGHALDELRATVGLLRQSGD 283

CP002047_8190: domain 1 of 1, from 150 to 217: score 79.1, E = 1.3e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+A ELHD v+Q L++++l +++a +l+ d+dp++a+ +l++i
CP002047_8 150 ERARLAHELHDAVSQKLFSLRLTAQAATALV--DRDPARAKGELQQI 194

relarealaevRrllgdLRpaal<-*
++la ea +e+R ++ +LRpaal
CP002047_8 195 AALAAEAADELRSAVVELRPAAL 217

CP002047_7615: domain 1 of 1, from 187 to 254: score 79.0, E = 1.3e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R +R+LHD +g+++s++ +++e++rrl+ ++d ++a +++ i
CP002047_7 187 ERLRFSRDLHDLLGHTMSVVVVKAEAVRRLA--PRDLDAALGQAADI 231

relarealaevRrllgdLRpaal<-*
++ +r+al+e+R++++++R++ l
CP002047_7 232 EAVGRQALTEIREAVTGYREGSL 254

CP002047_7242: domain 1 of 1, from 209 to 276: score 78.4, E = 2e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHD+ Q+L ++++ l+la++ l + peear+ +de+
CP002047_7 209 ERRRIERDLHDGAQQRLVSMAVNLGLAKATL--GDLPEEARKVIDEA 253

relarealaevRrllgdLRpaal<-*
++ a+ea++e+ +l+++L+pa+l
CP002047_7 254 HREAKEAIEELNNLVRGLHPAVL 276

CP002047_2217: domain 1 of 1, from 192 to 259: score 77.2, E = 4.6e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+v+++L++++ q+++a++l+ + +p++a + l+ +
CP002047_2 192 ERMRIARELHDVVAHHLALANAQASTAAHLA--RNHPDQAHKILTGL 236

relarealaevRrllgdLRpaal<-*
+ + + al+e+ +++g LR +++
CP002047_2 237 ASTTSSALRELKATVGLLRRTDD 259

CP002047_6838: domain 1 of 1, from 200 to 267: score 76.5, E = 7.1e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R AR+LHD +g sLs i+l+ el++rl+ + ++ +a+++l+ei
CP002047_6 200 ERLRFARDLHDLLGYSLSTITLKCELVHRLV--PPENSRAQQELAEI 244

relarealaevRrllgdLRpaal<-*
+++r+ala+vR++++++R + l
CP002047_6 245 LQTSRQALADVRAVASGYRMMSL 267

CP002047_5185: domain 1 of 1, from 195 to 262: score 74.5, E = 2.7e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R+LHD+ +L a+++ ++la+r++ dkdp++ar+ ld +
CP002047_5 195 ELRRIERDLHDGAQARLVALSMRVGLAKRAY--DKDPDAARKLLDDA 239

relarealaevRrllgdLRpaal<-*
+ a+eal+e+R+++++++p++l
CP002047_5 240 QNQAEEALTELRHVVRGIHPPIL 262

CP002047_4819: domain 1 of 1, from 165 to 230: score 74.5, E = 2.9e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+ARE+HD+v+++ s+i+lq+++++ + +++ +are +++i
CP002047_4 165 ERARLAREMHDVVAHQVSLISLQAGAVQISA--ADA--QARESARTI 207

relarealaevRrllgdLRpaal<-*
rel+ ++l+e+R+++g+LR a+
CP002047_4 208 RELSVRTLDELRHMVGVLRAAGG 230

CP002047_6810: domain 1 of 1, from 225 to 290: score 74.3, E = 3.2e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+A E+HD+++Q+L++i+ ql+++ ++dp+ are+ld++
CP002047_6 225 ERRRLAAEIHDTIAQGLTGIITQLQVVSS----TADPGLAREHLDRA 267

relarealaevRrllgdLRpaal<-*
++lar++l e+Rr +++L paal
CP002047_6 268 QALARRSLGEARRSVQNLSPAAL 290

CP002047_0838: domain 1 of 1, from 229 to 296: score 74.1, E = 3.6e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R ARE+HD vg++Ls++ +++a++l+ + +e+ +eal+ +
CP002047_0 229 ERSRVAREMHDIVGHNLSVMVGVADGAATLA--TNRNEQSAEALRIL 273

relarealaevRrllgdLRpaal<-*
++++r+a++e+Rr+lg+LR++++
CP002047_0 274 ADTGRQAMSELRRVLGVLREGQD 296

CP002047_1648: domain 1 of 1, from 208 to 275: score 73.8, E = 4.5e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+R+A+ELHDs+g++L+a+++q+ +a+ l+ d++pe+ar+al i
CP002047_1 208 GRNRLAQELHDSIGHTLTAATIQAAVAAELM--DREPEAARRALSSI 252

relarealaevRrllgdLRpaal<-*
+e +r a++++ ++lg+LR++
CP002047_1 253 EESSRSAMDDLDHVLGVLREGKA 275

CP002047_0410: domain 1 of 1, from 171 to 237: score 72.0, E = 1.5e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARELHD+v ++ +a+ +q+e+ar+l+ ++p+++++al+++
CP002047_0 171 ERARIARELHDVVTHHVTAMVVQAEAARYLT---AAPDRLDQALTAV 214

relarealaevRrllgdLRpaal<-*
+++r+a a++R+ll + p+
CP002047_0 215 TDAGRRATADLRHLLDLINPDHG 237

CP002047_1021: domain 1 of 1, from 170 to 235: score 71.8, E = 1.7e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIAR++HDs+g++Ls++++q+ +++ ++ p++ rea++++
CP002047_1 170 ERLRIARDMHDSLGHRLSLVSVQAAALEV----AELPAAQREAVRQL 212

relarealaevRrllgdLRpaal<-*
+++ar a++e+ +l+g+LR +++
CP002047_1 213 AGTARGAMDELHELVGALRGTDE 235

CP002047_7485: domain 1 of 1, from 197 to 262: score 71.6, E = 2.1e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHD+v Q++ a+ + l++arr dp++ar+ l ++
CP002047_7 197 ERRRIERDLHDGVQQRIVALGMLLGRARR----SQDPDKARALLVQA 239

relarealaevRrllgdLRpaal<-*
+e +r al+++R+++++ p+al
CP002047_7 240 HEESRAALTDLREVAWRVYPTAL 262

CP002047_7758: domain 1 of 1, from 228 to 295: score 71.2, E = 2.7e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R+LHD+ +L a+ + l+++++l+ +kdp++a+e l+++
CP002047_7 228 ELRRIERDLHDGAQARLVAMGMSLGTVEALM--EKDPAKAKELLAAA 272

relarealaevRrllgdLRpaal<-*
r+ + ealae+R+l+++++p++l
CP002047_7 273 RASSAEALAELRDLVRGIHPPVL 295

CP002047_5584: domain 1 of 1, from 255 to 323: score 71.0, E = 3e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARELHD+v ++ s++++q+++ar+++ ++ p++areal ++
CP002047_5 255 ERARIARELHDVVTHNVSVMIIQAGAARKVM--AATPDRAREALLAV 299

relarealaevRrllgdLR.paal<-*
++ +r a+ae+R++ g L ++++
CP002047_5 300 EASGRAAMAELRHAMGLLTmDDGD 323

CP002047_4813: domain 1 of 1, from 201 to 261: score 71.0, E = 3.1e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+AR++HD+++Q++++i + +e+ar+ l ++dp++ +++l+ i
CP002047_4 201 ERERMARDIHDTLAQGFASIVVLAEAARAGL--AADPARSAQQLRSI 245

relarealaevRrllg<-*
+ +are lae+R+l+g
CP002047_4 246 ESTARENLAEARELVG 261

CP002047_6768: domain 1 of 1, from 240 to 307: score 70.9, E = 3.3e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R+LHD+ +L a+ + l++a+rll +kdpe+ar+ l+
CP002047_6 240 ELRRIERDLHDGAQARLVAMGMNLGVAERLL--AKDPEAARAILADT 284

relarealaevRrllgdLRpaal<-*
r+++ al+e+R+l+++++p++l
CP002047_6 285 RQASAAALNELRDLVRGIHPPVL 307

CP002047_5875: domain 1 of 1, from 331 to 414: score 70.9, E = 3.3e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.........
ER+R++RELHDsv+Q+L +i+l++ +ar ll ++++++++++++
CP002047_5 331 ERRRLSRELHDSVSQALYGIILGACTARELL--NRNAAggdtdgdta 375

.......earealdeirelarealaevRrllgdLRpaal<-*
+++ + +e++e +d ir+la+ a+a++R llg+LRp +l
CP002047_5 376 rdpagmsELAEPIDYIRQLADAAIADTRVLLGRLRPETL 414

CP002047_5904: domain 1 of 1, from 235 to 300: score 70.1, E = 5.7e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHD+ Q+L a+++ l+lar d++p++++++l+ +
CP002047_5 235 ERRRIERDLHDGAQQRLVALTMTLGLARL----DAPPGPLADQLAKA 277

relarealaevRrllgdLRpaal<-*
++ a + lae+R+l+++++p++l
CP002047_5 278 HGEAGKVLAELRELIHGIHPQVL 300

CP002047_3825: domain 1 of 1, from 198 to 258: score 68.4, E = 1.7e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARE+HD+++Q++++i + +e+ar+++ d dpe+ +++l i
CP002047_3 198 ERERLAREIHDTLAQGFASIVVLAEAARAAA--DGDPERCAQQLISI 242

relarealaevRrllg<-*
+++are lae+R l+g
CP002047_3 243 EQTARENLAEARVLVG 258

CP002047_5719: domain 1 of 1, from 211 to 278: score 68.3, E = 1.9e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R R+LHD+ g +L++i+l++ela +l+ ++ +ea+e++ e+
CP002047_5 211 ERLRFGRDLHDVMGRNLAVIALKSELAVQLA--RRGRPEAAEQMVEV 255

relarealaevRrllgdLRpaal<-*
+++a+e+++e+R++++++R a+l
CP002047_5 256 QRIAQESQREIRDVVRGYRAADL 278

CP002047_7177: domain 1 of 1, from 193 to 265: score 68.0, E = 2.3e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.....eare
ER RIAR+LHD +++s+++i +q+++a+++l +dp++ +++ + +
CP002047_7 193 ERLRIARDLHDLLAHSITLIGVQTSVAAHVL--IADPDrldrgTLVK 237

aldeirelarealaevRrllgdLRpaal<-*
ald i +++r+a ae+R++l++LR ++
CP002047_7 238 ALDSISDTCRDARAELRATLQVLRAGEG 265

CP002047_5519: domain 1 of 1, from 204 to 270: score 67.2, E = 4e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
ER+RI R+LHD+ Q+L a++++l+la + p++++a+++++
CP002047_5 204 ERRRIERDLHDGAQQRLVALTMKLGLAG-----LDLPAgsRAAREVA 245

eirelarealaevRrllgdLRpaal<-*
e++++a++al+e+R+l+++ +p++l
CP002047_5 246 EAHRMAKDALTELRELIRGVHPQVL 270

CP002047_9681: domain 1 of 1, from 199 to 259: score 65.3, E = 1.5e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARE+HD+++Q++++i + +e+ar+++ +dp + +e+l+ i
CP002047_9 199 ERERLAREIHDTLAQGFASIVVLAEAARAVT--VTDPVRCAEQLTSI 243

relarealaevRrllg<-*
+++are lae+R l+g
CP002047_9 244 EQTARENLAEARVLVG 259

CP002047_8842: domain 1 of 1, from 234 to 299: score 60.2, E = 4.5e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +R+ARELHDs+g++L+++ +q+++ar+ + +e ++al++i
CP002047_8 234 EHNRLARELHDSIGHALTVAVVQAGAARA----AGSAEFTDRALAAI 276

relarealaevRrllgdLRpaal<-*
+e++r+al+++ r+l+ LR+++
CP002047_8 277 EETGRHALEDLERVLRLLREDTA 299

CP002047_2966: domain 1 of 2, from 182 to 247: score 59.9, E = 5.7e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+A E+HD+v ++ s++ lq++++r + +++ + r+a++e+
CP002047_2 182 ERARLAGEMHDVVTHRVSLMVLQAGALRITA--PDE--ATRQAAEEL 224

relarealaevRrllgdLRpaal<-*
r+++ +al+e+R+l+g LR+a +
CP002047_2 225 RAAGCQALDELRDLVGILRTAPE 247

CP002047_4857: domain 1 of 1, from 225 to 292: score 57.9, E = 2.2e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R+LHD+ +L ++ l l +a++l+ ++dp++a++ ++e+
CP002047_4 225 EIRRIERDLHDGAQARLVMLGLSLATAEKLM--ETDPDQAKALMREA 269

relarealaevRrllgdLRpaal<-*
r a ++l+e+R+l++++ p++l
CP002047_4 270 RVGAATSLTELRELVHGINPPVL 292

CP002047_3772: domain 1 of 1, from 191 to 256: score 56.9, E = 4.3e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+ARELHD v+ +Lsai++++ +a+ l d++ + ++al+ i
CP002047_3 191 ERGRMARELHDRVAGHLSAIAIHSTAALSLG--DAA--ATDQALTVI 233

relarealaevRrllgdLRpaal<-*
re + +lae+Rrl+ LR+a+
CP002047_3 234 RENSVLGLAEMRRLIELLRDAGG 256

CP002047_3680: domain 1 of 1, from 184 to 250: score 55.7, E = 9.9e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe...eareal
ER RIA ++HDs+g+ L++i+l + ++ + dpe +++ r+a+
CP002047_3 184 ERSRIAGDMHDSLGHDLALIALRAAAL------QIDPElsdRHRAAA 224

deirelarealaevRrllgdLRpaal<-*
+e+re+a++a +++R+++g+LR++++
CP002047_3 225 AELREAASTATSQLRDIIGVLRTGDD 250

CP002047_6128: domain 1 of 1, from 256 to 323: score 55.1, E = 1.4e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
+RI R+LHD+ +L a+++ l+la+ l ++dpe+a++ +de+
CP002047_6 256 DLRRIERDLHDGAQARLVALAMDLGLAKEKL--QEDPEAAARMVDEA 300

relarealaevRrllgdLRpaal<-*
++ ++ al+e+R+l+++++pa+l
CP002047_6 301 HGEVKLALQELRDLARGIHPAIL 323

CP002047_9295: domain 1 of 1, from 375 to 440: score 54.7, E = 1.9e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RIAR+LHD Q+L+a l l+ a rl+ + + ea+e++ ++
CP002047_9 375 DRDRIARDLHDLAIQRLFATGLTLQSAGRLI--KHP--EAAERVGRA 417

relarealaevRrllgdLRpaal<-*
+ ++e+++ +R ++ +LR ++
CP002047_9 418 VDDLDETIKIIRSTIFALRVVGD 440

CP002047_6129: domain 1 of 1, from 203 to 270: score 53.9, E = 3.4e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
+RI R+LHD+ +L a++++l+la+ + +dp++a++ +de+
CP002047_6 203 DLRRIERDLHDGAQARLVALAMGLGLAKEKV--LEDPGAAAAMVDEA 247

relarealaevRrllgdLRpaal<-*
++ ++ al+e+R+l+++++pa+l
CP002047_6 248 HGEGKLALQELRDLARGIHPAVL 270

CP002047_7233: domain 1 of 1, from 224 to 291: score 52.8, E = 7.1e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R+LHD+ +L a+ + l+ a rll d d ++ar+ l +
CP002047_7 224 ELRRIERDLHDGAQARLVALGMTLDEATRLL--DVDLDAARQLLLDV 268

relarealaevRrllgdLRpaal<-*
re++ +al+++R+l+++++p++l
CP002047_7 269 RETSARALQDLRDLVHGIQPPVL 291

CP002047_3479: domain 1 of 1, from 472 to 538: score 49.2, E = 8.1e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.earealde
ER+R+ RE+HD++g +L+a++l l+ a++ +p+++ar +l+e
CP002047_3 472 ERRRLRREIHDGLGPQLAAVRLRLDIAQTTC----PPGhPARHQLRE 514

irelarealaevRrllgdLRpaal<-*
++e++ eal evRr+ ++L paal
CP002047_3 515 AAETLAEALVEVRRITSGLAPAAL 538

CP002047_4995: domain 2 of 2, from 498 to 562: score 45.6, E = 9e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R AR+LHD +g+sL+++ l elar + +pe+ar++l+ +
CP002047_4 498 ERLRAARDLHDLLGHSLAGMLLTCELAR-----RLPPEQARTQLTSV 539

relarealaevRrllgdLRpaal<-*
++a+++ a++R++ g+ + l
CP002047_4 540 LAMAERGEADLRAASGGAGSMSL 562

CP002047_5879: domain 1 of 1, from 420 to 485: score 45.6, E = 9.1e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIA ++HD Q ++a++l l+ +rr+l +++ ++ ++ +
CP002047_5 420 ERGRIAADIHDDTIQVITAASLRLQQLRRRL--RDP--DEQRIMEKL 462

relarealaevRrllgdLRpaal<-*
e+++ +l+ +R+l+ dLRp+ l
CP002047_5 463 DETLKLSLSRLRQLIFDLRPSSL 485

CP002047_9094: domain 1 of 1, from 373 to 438: score 37.6, E = 2.1e-10
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RIAR+LHD Q+L+a+ + l+ r + + e e+l ++
CP002047_9 373 DRDRIARDLHDLAIQRLFAAGMSLQSTMRFV--PHS--EGSERLLRV 415

relarealaevRrllgdLRpaal<-*
+ ++++++ +R ++ +LR +
CP002047_9 416 VDDLDDTIRIIRSTIFGLRSHEA 438


Histogram of all scores:
score obs exp (one = represents 25 sequences)
----- --- ---
-14 21 0|=
-13 106 1|*====
-12 194 111|====*===
-11 297 918|============ *
-10 916 2131|===================================== *
-9 1446 2420|==========================================================*
-8 1359 1865|======================================================= *
-7 1380 1172|==============================================*=========
-6 1175 663|==========================*====================
-5 1197 355|==============*=================================
-4 652 185|=======*===================
-3 440 95|===*==============
-2 273 48|=*=========
-1 193 24|*=======
0 128 12|*=====
1 75 6|*==
2 43 3|*=
3 22 1|*
4 13 0|=
5 15 0|=
6 5 0|=
7 7 0|=
8 2 0|=
9 4 0|=
10 2 0|=
11 0 0|
12 2 0|=
> 13 55 -|===


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 10483.1406
P(chi-square) = 0

Total sequences searched: 10022

Whole sequence top hits:
tophits_s report:
Total hits: 53
Satisfying E cutoff: 53
Total memory: 22K

Domain top hits:
tophits_s report:
Total hits: 53
Satisfying E cutoff: 53
Total memory: 39K


Acknowledgements:

This research is funded by:

Developed by: