Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
7 projects found  

1 accessions found for Truepera radiovictrix DSM 17093  

Data for CP002049  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP002049.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP002049_1469 CDS_1596780-1595254 86.5 2.5e-25 1
CP002049_0768 CDS_846526-848391 82.9 2.8e-24 2
CP002049_1771 CDS_1929311-1927500 70.2 1.5e-20 1
CP002049_2474 CDS_2737451-2736294 69.3 2.8e-20 1
CP002049_0268 CDS_314993-316585 47.2 9.1e-14 1
CP002049_2732 CDS_3020031-3018634 42.0 3.2e-12 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP002049_1469 1/1 311 378 .. 1 70 [] 86.5 2.5e-25
CP002049_0768 2/2 416 487 .. 1 70 [] 80.5 1.4e-23
CP002049_1771 1/1 406 467 .. 1 70 [] 70.2 1.5e-20
CP002049_2474 1/1 192 261 .. 1 70 [] 69.3 2.8e-20
CP002049_0268 1/1 317 384 .. 1 70 [] 47.2 9.1e-14
CP002049_2732 1/1 265 332 .. 1 70 [] 42.0 3.2e-12

Alignments of top-scoring domains:
CP002049_1469: domain 1 of 1, from 311 to 378: score 86.5, E = 2.5e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARELHDsv+Q+L +i+l++ a+ ll +++pe+++e+l+ +
CP002049_1 311 ERQRLARELHDSVSQALYGIALGSKSALSLL--KTHPERVEERLQYV 355

relarealaevRrllgdLRpaal<-*
++a+ a++e+R+l+ +LRp l
CP002049_1 356 LAMAEAAMSEMRALIFELRPEML 378

CP002049_0768: domain 2 of 2, from 416 to 487: score 80.5, E = 1.4e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe....earea
ERaRIARE+HD+v+QsL+ +l+l+l+ r+l + + + + ++a+++
CP002049_0 416 ERARIAREIHDGVAQSLAFSALKLDLVGRML--AQPGGagleKAAAE 460

ldeirelarealaevRrllgdLRpaal<-*
l++ ++++rea++evRr + +LRp +l
CP002049_0 461 LEATKKTIREAIREVRRSIFALRPIDL 487

CP002049_1771: domain 1 of 1, from 406 to 467: score 70.2, E = 1.5e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRI+R+LHD+vgQ+L+a+ l+l +a ++ + eal ++
CP002049_1 406 ERARISRDLHDGVGQALTALGLGLNAA------LDN--PTPEALGAL 444

relarealaevRrllgdLRpaal<-*
r+l+ e+l++vRr+ +dLRpa l
CP002049_1 445 RRLVAETLEDVRRISRDLRPALL 467

CP002049_2474: domain 1 of 1, from 192 to 261: score 69.3, E = 2.8e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.earealde
ER RIARELHD +g++L+a++l le+a +l ++ e++a +++++
CP002049_2 192 ERLRIARELHDLIGHHLTALSLNLEVASFVL--EAQGEsKALAHVRT 236

irelarealaevRrllgdLR.paal<-*
+ la+ l +vR+++++ R + l
CP002049_2 237 SQSLAKGLLGDVREVVSEVRaGSSL 261

CP002049_0268: domain 1 of 1, from 317 to 384: score 47.2, E = 9.1e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +R AR+LHD++gQ+L++ + + ++++l + + ++ +++++++
CP002049_0 317 EQQRVARDLHDTLGQHLAGTAFLARNLATRL--RGAGAPYADEAARV 361

relarealaevRrllgdLRpaal<-*
+el++ea a++R l+++L p al
CP002049_0 362 AELVQEAVAQTRSLARGLFPVAL 384

CP002049_2732: domain 1 of 1, from 265 to 332: score 42.0, E = 3.2e-12
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RIA ELHD + Q+L + +lq+ +++r l ++ ++ ++e+++++
CP002049_2 265 EQQRIAGELHDALQQHLIGTALQAKALARTL--ASRNDDLAERAEAL 309

relarealaevRrllgdLRpaal<-*
+l++ + + +R +++++ p +
CP002049_2 310 YGLVQAGVTSLRTVVQGMAPVQR 332


Histogram of all scores:
score obs exp (one = represents 8 sequences)
----- --- ---
-14 7 0|=
-13 24 0|===
-12 29 32|===*
-11 62 269|======== *
-10 259 626|================================= *
-9 393 711|================================================== *
-8 428 548|====================================================== *
-7 430 344|==========================================*===========
-6 358 195|========================*====================
-5 403 104|============*======================================
-4 200 54|======*==================
-3 126 28|===*============
-2 81 14|=*=========
-1 51 7|*======
0 41 3|*=====
1 13 1|*=
2 12 0|==
3 8 0|=
4 7 0|=
5 5 0|=
6 0 0|
7 0 0|
8 1 0|=
9 0 0|
> 10 7 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 2852.5618
P(chi-square) = 0

Total sequences searched: 2945

Whole sequence top hits:
tophits_s report:
Total hits: 6
Satisfying E cutoff: 6
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 6
Satisfying E cutoff: 6
Total memory: 23K


Acknowledgements:

This research is funded by:

Developed by: