Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
76 projects found  

1 accessions found for Methylotenera sp. 301  

Data for CP002056  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP002056.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP002056_1384 CDS_1545965-1544136 63.0 1.9e-18 1
CP002056_0957 CDS_1088022-1089479 56.5 1.5e-16 1
CP002056_0478 CDS_536645-538381 51.3 5.2e-15 1
CP002056_0882 CDS_1009623-1010984 48.2 4.4e-14 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP002056_1384 1/1 410 480 .. 1 70 [] 63.0 1.9e-18
CP002056_0957 1/1 288 355 .. 1 70 [] 56.5 1.5e-16
CP002056_0478 1/1 372 440 .. 1 70 [] 51.3 5.2e-15
CP002056_0882 1/1 242 309 .. 1 70 [] 48.2 4.4e-14

Alignments of top-scoring domains:
CP002056_1384: domain 1 of 1, from 410 to 480: score 63.0, E = 1.9e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.earealde
ERa IARELHDs++QsLs +k q+ ++++ + + e+ a++ +
CP002056_1 410 ERAVIARELHDSLAQSLSYMKFQIARLQTNFG-TQLIEsGADTIVND 455

irelarealaevRrllgdLR.paal<-*
+re ++ a++e+R+ll+++R ++
CP002056_1 456 MREGLDNAYRELRELLTTFRvQMDV 480

CP002056_0957: domain 1 of 1, from 288 to 355: score 56.5, E = 1.5e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER IARE+HD +g +L+aik++l+ + l k + e+++ +
CP002056_0 288 ERSAIAREIHDDLGGNLTAIKMGLSSIINKL--SKGQDVTIEQAQGL 332

relarealaevRrllgdLRpaal<-*
+ +++ + + v r+ +dLRp +l
CP002056_0 333 ESILDSTFEAVHRISSDLRPNVL 355

CP002056_0478: domain 1 of 1, from 372 to 440: score 51.3, E = 5.2e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.earealde
ER+R + ELHD++gQ+Lsa+k +e+ + + ++p +e ++l++
CP002056_0 372 ERQRVSSELHDGIGQTLSAVKFCVEAGIKSI--CEHPTeESFRHLEN 416

irelarealaevRrllgdLRpaal<-*
+ +++a++evRr+ +LRp+ l
CP002056_0 417 VIPKIQHAIEEVRRISMALRPSML 440

CP002056_0882: domain 1 of 1, from 242 to 309: score 48.2, E = 4.4e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ +ARELHD++gQ +aik + +++ + ++ + + ++ i
CP002056_0 242 ERRSLARELHDELGQYVTAIKTFAVAIANKT--KEKSPDISSNAQVI 286

relarealaevRrllgdLRpaal<-*
+a++ ++ + ++++ LRp+al
CP002056_0 287 VSAANQIYDGMHNIVRKLRPGAL 309


Histogram of all scores:
score obs exp (one = represents 10 sequences)
----- --- ---
-15 2 0|=
-14 24 0|===
-13 80 0|========
-12 120 30|==*=========
-11 227 253|======================= *
-10 509 587|=================================================== *
-9 536 667|====================================================== *
-8 424 514|=========================================== *
-7 290 323|============================= *
-6 204 183|==================*==
-5 162 98|=========*=======
-4 66 51|=====*=
-3 47 26|==*==
-2 25 13|=*=
-1 20 6|*=
0 6 3|*
1 8 1|*
2 4 0|=
3 2 0|=
4 2 0|=
5 1 0|=
6 0 0|
> 7 5 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 415.1922
P(chi-square) = 0

Total sequences searched: 2764

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: