Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
39 projects found  

3 accessions found for 'Nostoc azollae' 0708  

Data for CP002059  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP002059.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP002059_0181 CDS_236420-237628 89.2 4.8e-26 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP002059_0181 1/1 203 270 .. 1 70 [] 89.2 4.8e-26

Alignments of top-scoring domains:
CP002059_0181: domain 1 of 1, from 203 to 270: score 89.2, E = 4.8e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HDs+g+sL+a++lqle+a++l ++d ++a + l+++
CP002059_0 203 ERNRIAREIHDSLGHSLTALNLQLETALKLS--KSDIPRAMTFLTRA 247

relarealaevRrllgdLRpaal<-*
+el+++al++vR+ ++++R l
CP002059_0 248 KELGSKALQDVRNSVSTMRSHPL 270


Histogram of all scores:
score obs exp (one = represents 11 sequences)
----- --- ---
-14 115 0|===========
-13 215 0|====================
-12 248 40|===*===================
-11 296 328|=========================== *
-10 603 763|======================================================= *
-9 640 866|==========================================================*
-8 448 667|========================================= *
-7 340 419|=============================== *
-6 237 237|=====================*
-5 205 127|===========*=======
-4 99 66|=====*===
-3 74 34|===*===
-2 29 17|=*=
-1 10 8|*
0 12 4|*=
1 4 2|*
2 6 1|*
3 1 0|=
4 4 0|=
5 0 0|
> 6 3 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1379.1061
P(chi-square) = 0

Total sequences searched: 3589

Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: