Crenarchaeota Euryarchaeota Nanoarchaeota
Other Archaea
Classification of phyla is from NCBI page
Search:
82 projects found  

2 accessions found for Methanohalobium evestigatum Z-7303  

Data for CP002069  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP002069.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP002069_0966 CDS_966729-968072 170.9 7.9e-49 1
CP002069_1649 CDS_1758418-1755788 165.0 4.5e-47 1
CP002069_0964 CDS_964176-966245 164.6 6.1e-47 1
CP002069_0436 CDS_445335-447464 158.0 4.8e-45 1
CP002069_2001 CDS_2102108-2099910 154.4 5.2e-44 1
CP002069_0942 CDS_942996-941284 153.3 1.1e-43 1
CP002069_1222 CDS_1281660-1283849 152.2 2.1e-43 1
CP002069_1114 CDS_1138415-1136211 150.9 5.2e-43 1
CP002069_1608 CDS_1699601-1701397 149.2 1.5e-42 1
CP002069_1376 CDS_1454313-1456451 145.1 2.2e-41 1
CP002069_0730 CDS_723550-724137 140.5 4.6e-40 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP002069_0966 1/1 257 345 .. 1 94 [] 170.9 7.9e-49
CP002069_1649 1/1 683 769 .. 1 94 [] 165.0 4.5e-47
CP002069_0964 1/1 490 573 .. 1 94 [] 164.6 6.1e-47
CP002069_0436 1/1 519 605 .. 1 94 [] 158.0 4.8e-45
CP002069_2001 1/1 541 627 .. 1 94 [] 154.4 5.2e-44
CP002069_0942 1/1 379 463 .. 1 94 [] 153.3 1.1e-43
CP002069_1222 1/1 539 625 .. 1 94 [] 152.2 2.1e-43
CP002069_1114 1/1 544 630 .. 1 94 [] 150.9 5.2e-43
CP002069_1608 1/1 407 493 .. 1 94 [] 149.2 1.5e-42
CP002069_1376 1/1 522 608 .. 1 94 [] 145.1 2.2e-41
CP002069_0730 1/1 9 95 .. 1 94 [] 140.5 4.6e-40

Alignments of top-scoring domains:
CP002069_0966: domain 1 of 1, from 257 to 345: score 170.9, E = 7.9e-49
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQvISSLL+L+a +f++ +v ea++ sqnRV+S
CP002069_0 257 EIHHRVKNNLQVISSLLNLEASNFESDDV-----VEAFKNSQNRVRS 298

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAl HE+LY+s+dl+t++f+eYl++L+ +Lfqsy v+ + i+L+lD+
CP002069_0 299 MALAHEKLYQSKDLKTINFGEYLKNLAMHLFQSYLVDTESIRLNLDV 345

CP002069_1649: domain 1 of 1, from 683 to 769: score 165.0, E = 4.5e-47
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQvISSLL+LQ+ +f+d+ v ++a++EsqnRV+S
CP002069_1 683 EIHHRVKNNLQVISSLLNLQSTNFEDKSV-----IKAFEESQNRVRS 724

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+Al HE+LY s d+ ++df+ Y++ Lt++L+q+y +++++i+L+ l
CP002069_1 725 IALAHEKLYNSSDMVSIDFGNYIQTLTDYLLQAYLDDNNNIELN--L 769

CP002069_0964: domain 1 of 1, from 490 to 573: score 164.6, E = 6.1e-47
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQvISSLL+L++ +f+d++v ea+r+sqnRV+S
CP002069_0 490 EIHHRVKNNLQVISSLLSLESGNFDDPDV-----VEAFRDSQNRVRS 531

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAl HEeLY+s+ + ++dfseY+++Lt++L+q+y+++ ++i +
CP002069_0 532 MALAHEELYQSKHVADIDFSEYVDNLTNYLIQTYRGKTNNI-----I 573

CP002069_0436: domain 1 of 1, from 519 to 605: score 158.0, E = 4.8e-45
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E HHR+KNNLQvISSLL+LQ++kf+d ev ++a+ ++qnRV+S
CP002069_0 519 ELHHRIKNNLQVISSLLSLQSEKFTDDEV-----KDAFIDTQNRVKS 560

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+l+H++LY++++l++v+ ++Y+e L+++L +yg++++ i+++ +
CP002069_0 561 MSLVHNKLYQTKGLENVNSKDYIEDLVDHLVGLYGGSNITIKID--V 605

CP002069_2001: domain 1 of 1, from 541 to 627: score 154.4, E = 5.2e-44
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E HHRVKNNLQvISSLL+LQ++kf+deev ea++++qnRV S
CP002069_2 541 ELHHRVKNNLQVISSLLSLQSEKFDDEEV-----YEAFKDTQNRVVS 582

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAl+HE+LY++ l+++d+ +Y++ L+++L+ +y +g++ ++++ +
CP002069_2 583 MALVHEKLYRTNHLENIDLNDYVNDLVNHLKGLYDGGNISLNID--V 627

CP002069_0942: domain 1 of 1, from 379 to 463: score 153.3, E = 1.1e-43
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E HHR+KNNLQvISSL++LQ++kf+deev ea+ ++qnR+ S
CP002069_0 379 ELHHRIKNNLQVISSLINLQSEKFDDEEV-----YEAFIDTQNRIVS 420

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+l+H++LY++ +l +++f++Y++ L+ +L ++yg+ ++ ++ +
CP002069_0 421 MSLVHQKLYQTSNLNSINFKDYIQDLLTHLTRLYGDNNITLD----V 463

CP002069_1222: domain 1 of 1, from 539 to 625: score 152.2, E = 2.1e-43
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E HHR+KNNLQvISSLL+LQ+++f+d +v ++a+ ++qnRV+S
CP002069_1 539 ELHHRIKNNLQVISSLLSLQSENFTDGKV-----KDAFIDTQNRVIS 580

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+l+H++LY++ +l++v+ ++Y+e L+++L +yg++++ i+++ +
CP002069_1 581 MSLVHNKLYQTNGLENVNSKDYIEDLVDHLVGLYGGSNITIKID--V 625

CP002069_1114: domain 1 of 1, from 544 to 630: score 150.9, E = 5.2e-43
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E HHR+KNNLQvISSLL+LQ++kf d v ea+r++qnRV+S
CP002069_1 544 ELHHRIKNNLQVISSLLNLQSEKFNDDTV-----NEAFRDTQNRVIS 585

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+l+H++ Y +++l+++++++Y+e L+e+L+++y+++++ i+++ +
CP002069_1 586 MSLVHQKIYHTKGLESINIRDYIEDLVEHLISLYNGENILIKID--I 630

CP002069_1608: domain 1 of 1, from 407 to 493: score 149.2, E = 1.5e-42
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E HHR+KNNLQvISSLL+LQ++kf+d +v ++a+ ++qnRV+S
CP002069_1 407 ELHHRIKNNLQVISSLLSLQSEKFTDDNV-----KDAFIDTQNRVIS 448

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+l+H++LY+ ++l++v+ ++Y+ ++++L ++y+ +++i+++ +
CP002069_1 449 MSLVHNKLYQAKGLENVNTKDYIGDIVDHLNELYNIPNIDINID--V 493

CP002069_1376: domain 1 of 1, from 522 to 608: score 145.1, E = 2.2e-41
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E HHR+KNNLQvISSLL+LQ++kf+de+v ea++++qnRV+S
CP002069_1 522 ELHHRIKNNLQVISSLLNLQSEKFEDEDV-----VEAFKDTQNRVIS 563

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+ +H++LY++ +ld+++ ++Y+++L+++L ++y++ +++++++ +
CP002069_1 564 MSFVHQKLYQTNNLDNLNSKDYIKELVSYLTNLYNKNNIDLNID--V 608

CP002069_0730: domain 1 of 1, from 9 to 95: score 140.5, E = 4.6e-40
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E HHR+KNNLQ+I SL++LQ+++f+de+v ++a+r++qnRV S
CP002069_0 9 ELHHRIKNNLQIINSLINLQSENFDDEDV-----INAFRDTQNRVSS 50

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+l+H++LY+s +l ++ + Y++ L+enL + yg+ + +i+++ +
CP002069_0 51 MSLVHQKLYQSQELNNLSLNGYIKDLAENLNDIYGGNNTKINVD--V 95


Histogram of all scores:
score obs exp (one = represents 8 sequences)
----- --- ---
-15 2 0|=
-14 6 0|=
-13 26 13|=*==
-12 79 141|========== *
-11 433 392|================================================*======
-10 438 508|======================================================= *
-9 438 429|=====================================================*=
-8 293 288|===================================*=
-7 160 171|==================== *
-6 133 95|===========*=====
-5 71 51|======*==
-4 27 27|===*
-3 11 14|=*
-2 9 7|*=
-1 2 3|*
0 5 2|*
1 2 1|*
2 1 0|=
3 0 0|
> 4 12 -|==


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 77.3886
P(chi-square) = 4.709e-12

Total sequences searched: 2148

Whole sequence top hits:
tophits_s report:
Total hits: 11
Satisfying E cutoff: 11
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 11
Satisfying E cutoff: 11
Total memory: 25K


Acknowledgements:

This research is funded by:

Developed by: