hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP002070.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP002070_0047 CDS_85725-86489 147.8 1.9e-43 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP002070_0047 1/1 64 150 .. 1 94 [] 147.8 1.9e-43
Alignments of top-scoring domains:
CP002070_0047: domain 1 of 1, from 64 to 150: score 147.8, E = 1.9e-43
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E HHR+KNNLQvISSLL+LQ++kf d v ea+r++qnRV+S
CP002070_0 64 ELHHRIKNNLQVISSLLNLQSEKFNDDTV-----NEAFRDTQNRVIS 105
mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+l+H++ Y +++l+++++++Y+e L+e+L+++y++++ ++++ +
CP002070_0 106 MSLVHQKIYHTKGLESINVRDYIEDLIEHLISLYNGEKTLVKID--I 150
Histogram of all scores:
score obs exp (one = represents 1 sequences)
----- --- ---
-14 1 0|=
-13 2 0|==
-12 3 6|=== *
-11 19 19|==================*
-10 16 25|================ *
-9 20 21|====================*
-8 19 14|=============*=====
-7 8 8|=======*
-6 3 4|===*
-5 9 2|=*=======
-4 2 1|*=
-3 1 0|=
-2 1 0|=
-1 0 0|
> 0 2 -|==
% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 4.9998
P(chi-square) = 0.2873
Total sequences searched: 106
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K