hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP002083.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP002083_2342 CDS_2431899-2430886 33.1 2.7e-09 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP002083_2342 1/1 146 219 .. 1 80 [. 33.1 2.7e-09
Alignments of top-scoring domains:
CP002083_2342: domain 1 of 1, from 146 to 219: score 33.1, E = 2.7e-09
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E HR +N L+ + LL++Qar++++ + ++a+ + +RV++
CP002083_2 146 ELSHRTRNDLANVVTLLNMQARSVDGVA------RDAMISAADRVQA 186
mAliHEeLYksedldtvdfseYlekLtenLfqs<-*
+A +H++ vd ++Y+ +L+++L+ s
CP002083_2 187 IARVHRRFQIHNHRVVVDTKSYIGELCDDLRLS 219
Histogram of all scores:
score obs exp (one = represents 17 sequences)
----- --- ---
-15 18 0|==
-14 36 0|===
-13 70 21|=*===
-12 233 230|=============*
-11 975 642|=====================================*====================
-10 730 831|=========================================== *
-9 575 702|================================== *
-8 410 470|========================= *
-7 198 279|============ *
-6 125 155|======== *
-5 68 83|====*
-4 37 44|==*
-3 14 23|=*
-2 10 12|*
-1 3 6|*
0 1 3|*
1 1 1|*
2 0 0|
3 1 0|=
4 0 0|
5 1 0|=
6 0 0|
7 1 0|=
8 0 0|
9 1 0|=
10 0 0|
11 1 0|=
12 0 0|
13 1 0|=
> 14 2 -|=
% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 358.7180
P(chi-square) = 0
Total sequences searched: 3512
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K