Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

1 accessions found for Hyphomicrobium denitrificans ATCC 51888  

Data for CP002083  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP002083.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP002083_3401 CDS_3504063-3505931 143.3 1e-48 1
CP002083_1348 CDS_1412986-1411061 122.3 1.5e-41 1
CP002083_0753 CDS_794180-791082 100.6 3.5e-34 1
CP002083_2653 CDS_2756746-2758704 90.4 1.1e-30 1
CP002083_0760 CDS_799118-801673 85.1 6.7e-29 1
CP002083_1346 CDS_1407979-1409052 80.3 3e-27 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP002083_3401 1/1 278 359 .. 1 85 [] 143.3 1e-48
CP002083_1348 1/1 294 376 .. 1 85 [] 122.3 1.5e-41
CP002083_0753 1/1 852 930 .. 1 85 [] 100.6 3.5e-34
CP002083_2653 1/1 444 526 .. 1 85 [] 90.4 1.1e-30
CP002083_0760 1/1 519 600 .. 1 85 [] 85.1 6.7e-29
CP002083_1346 1/1 155 237 .. 1 85 [] 80.3 3e-27

Alignments of top-scoring domains:
CP002083_3401: domain 1 of 1, from 278 to 359: score 143.3, E = 1e-48
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA+VQSia+QT+++a s+ +f+++F gRLq+L+ +H+L
CP002083_3 278 ELNHRVKNTLATVQSIANQTVHRAKSPGDFATSFGGRLQSLAKTHSL 324

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt+s W+gA+L+eL++ +L P+g++ +eRit sGP
CP002083_3 325 --LTQSTWQGAELSELIRDQL-PFGDNEDERITCSGPL 359

CP002083_1348: domain 1 of 1, from 294 to 376: score 122.3, E = 1.5e-41
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKN+LA+V +iar ++ na+s+d f+ a++gR++A+s+aHdL
CP002083_1 294 ELDHRVKNILANVAAIARLSSSNATSIDTFASALDGRIHAMSAAHDL 340

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L +s+W g+dL++L++ +L+P+ + + +i+++G++
CP002083_1 341 --LRQSSWTGVDLHKLVAGALEPFKSRTDNDIVIEGER 376

CP002083_0753: domain 1 of 1, from 852 to 930: score 100.6, E = 3.5e-34
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR+KN+ AvVQ+ia Q+lR ++ d+ + ++ RL+AL+ +HdL
CP002083_0 852 ELSHRFKNIYAVVQAIAGQSLRDSGATDSTRNTLNSRLRALAISHDL 898

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L++ eW+++ + Ll+++L +R++++GP+
CP002083_0 899 --LVQNEWQSVAFERLLSEQLTGM----TDRFRFEGPH 930

CP002083_2653: domain 1 of 1, from 444 to 526: score 90.4, E = 1.1e-30
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E++HR+KN LA++ ++ar T+R a ++++ + F+ R + Ls+++dL
CP002083_2 444 EVSHRSKNMLALILAMARLTARDAVDVKSHLKEFALRVAGLSASQDL 490

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
++ ++W+++d++ L++ae+++ + da R+ +sGP+
CP002083_2 491 --IVAADWQSVDFARLASAEIEAVARSDASRVKISGPP 526

CP002083_0760: domain 1 of 1, from 519 to 600: score 85.1, E = 6.7e-29
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRV+N+L v+ +++rQ+ ++ ++ fv+ ++gR++AL+raH++
CP002083_0 519 ELNHRVRNILGVIRGLIRQSQPDEDAVAKFVQLVDGRIHALARAHNQ 565

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+t+++W++A L +++ ae a +++a+Ri GP+
CP002083_0 566 --ITDDHWGPAPLQAIVDAESASI-SAGADRIGGGGPP 600

CP002083_1346: domain 1 of 1, from 155 to 237: score 80.3, E = 3e-27
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL HR KNt+Av+ +++ Q++R + ++++f+ ++sgRL+A++ a dL
CP002083_1 155 ELRHRLKNTFAVIAGLVSQSARYSMDVQSFAKSLSGRLAAMGTAMDL 201

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+ ++ gA+L eL+ +L P +++a R t++G d
CP002083_1 202 --VATRSFLGASLNELIVDTLKPLVPPGAARMTIQGAD 237


Histogram of all scores:
score obs exp (one = represents 11 sequences)
----- --- ---
-16 1 0|=
-15 0 0|
-14 19 0|==
-13 78 0|========
-12 315 0|=============================
-11 373 28|==*===============================
-10 559 363|================================*==================
-9 611 898|======================================================== *
-8 603 933|======================================================= *
-7 385 626|=================================== *
-6 239 342|====================== *
-5 145 169|============== *
-4 69 80|=======*
-3 58 37|===*==
-2 23 17|=*=
-1 17 7|*=
0 3 3|*
1 3 1|*
> 2 11 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 4598.5171
P(chi-square) = 0

Total sequences searched: 3512

Whole sequence top hits:
tophits_s report:
Total hits: 6
Satisfying E cutoff: 6
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 6
Satisfying E cutoff: 6
Total memory: 23K


Acknowledgements:

This research is funded by:

Developed by: