Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
14 projects found  

1 accessions found for Dehalogenimonas lykanthroporepellens BL-DC-9  

Data for CP002084  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP002084.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP002084_0722 CDS_736071-739241 119.6 3.2e-34 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP002084_0722 1/1 860 948 .. 1 94 [] 119.6 3.2e-34

Alignments of top-scoring domains:
CP002084_0722: domain 1 of 1, from 860 to 948: score 119.6, E = 3.2e-34
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNN+QvISSLL +Q + + de + ++ L+Esq R++S
CP002084_0 860 EIHHRVKNNMQVISSLLKMQGQFVNDEST-----RAMLQESQERIKS 901

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+l++++LY+s dl + ++eY+ +L+ nL ++y+ + d ++ +lD+
CP002084_0 902 MSLVYNKLYQSSDLACIGMKEYVPELVTNLVHAYATSPDSVKPELDV 948


Histogram of all scores:
score obs exp (one = represents 7 sequences)
----- --- ---
-15 2 0|=
-14 11 0|==
-13 31 10|=*===
-12 93 108|============== *
-11 410 303|===========================================*===============
-10 318 392|============================================== *
-9 281 331|========================================= *
-8 196 222|============================ *
-7 123 132|==================*
-6 122 73|==========*=======
-5 27 39|==== *
-4 21 20|==*
-3 11 11|=*
-2 9 5|*=
-1 1 2|*
> 0 3 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 144.0966
P(chi-square) = 2.387e-25

Total sequences searched: 1659

Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: