Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
14 projects found  

1 accessions found for Dehalogenimonas lykanthroporepellens BL-DC-9  

Data for CP002084  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP002084.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP002084_1434 CDS_1465188-1463971 56.4 1e-16 1
CP002084_0672 CDS_677885-678835 49.4 1.2e-14 1
CP002084_1096 CDS_1120689-1119922 46.1 1.1e-13 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP002084_1434 1/1 197 265 .. 1 70 [] 56.4 1e-16
CP002084_0672 1/1 106 173 .. 1 70 [] 49.4 1.2e-14
CP002084_1096 1/1 32 101 .. 1 70 [] 46.1 1.1e-13

Alignments of top-scoring domains:
CP002084_1434: domain 1 of 1, from 197 to 265: score 56.4, E = 1e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIAR++HD v +L +++l + +++r l + +++ ea+ i
CP002084_1 197 ERQRIARDMHDNVLKTLHGLALETKVLERKL--GDGEPAISEAVSYI 241

relarealaevRrllgdLR.paal<-*
+ +r++ +evR+++ dLR+++++
CP002084_1 242 GDVCRRTSREVRDVILDLRhETVD 265

CP002084_0672: domain 1 of 1, from 106 to 173: score 49.4, E = 1.2e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIA+ELHD +Q L ai+ ++++ l ++ ++ ++ i
CP002084_0 106 ERRRIAQELHDDTAQDLIAISRKIDGYMSLH--PSLSSTDEAYFEDI 150

relarealaevRrllgdLRpaal<-*
+++++++l+ vRr +dLRp++l
CP002084_0 151 HQHLNRTLSSVRRFSQDLRPSVL 173

CP002084_1096: domain 1 of 1, from 32 to 101: score 46.1, E = 1.1e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
ER+RIARELHD+v+ sL +++ ++++ ++ ++ ++ ++
CP002084_1 32 ERKRIARELHDEVSPSLLLLIQRIDTIVSNS--KTLKLseTMKDKME 76

eirelarealaevRrllgdLRpaal<-*
+r eal+ +Rr+++dLRp +l
CP002084_1 77 DLRVQTVEALESTRRIAQDLRPRIL 101


Histogram of all scores:
score obs exp (one = represents 5 sequences)
----- --- ---
-14 12 0|===
-13 50 0|==========
-12 54 18|===*=======
-11 115 152|======================= *
-10 249 352|================================================== *
-9 291 400|==========================================================*
-8 237 308|================================================ *
-7 210 194|======================================*===
-6 127 109|=====================*====
-5 139 58|===========*================
-4 59 30|=====*======
-3 39 15|==*=====
-2 26 8|=*====
-1 18 4|*===
0 10 2|*=
1 6 1|*=
2 5 0|=
3 1 0|=
4 1 0|=
5 0 0|
6 2 0|=
7 1 0|=
> 8 7 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 366.5147
P(chi-square) = 0

Total sequences searched: 1659

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: