Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
35 projects found  

3 accessions found for Desulfotalea psychrophila LSv54  

Data for CR522870  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_1.hmm [HisKA]
Sequence database: CR522870.Gprot.fsa
per-sequence score cutoff: >= 26.8 [TC1]
per-domain score cutoff: >= 26.8 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA
Accession: PF00512.12
Description: His Kinase A (phosphoacceptor) domain
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CR522870_0359 CDS_388344-385612 98.0 1.5e-27 1
CR522870_1886 CDS_2120504-2122312 90.5 2e-25 1
CR522870_1793 CDS_2024548-2020472 83.0 2.7e-23 1
CR522870_2292 CDS_2629831-2626523 78.8 4.2e-22 1
CR522870_0883 CDS_990880-994005 75.1 4.7e-21 1
CR522870_0954 CDS_1064859-1063639 61.0 4.8e-17 1
CR522870_2635 CDS_2998704-2996938 59.6 1.1e-16 1
CR522870_0375 CDS_406256-407947 57.4 4.7e-16 1
CR522870_2722 CDS_3083495-3085168 56.9 6.7e-16 1
CR522870_1041 CDS_1179195-1177720 47.6 3e-13 1
CR522870_1924 CDS_2176753-2179797 47.1 4.1e-13 1
CR522870_2822 CDS_3181280-3183550 46.7 5.4e-13 1
CR522870_1926 CDS_2183538-2186594 46.3 6.9e-13 1
CR522870_1925 CDS_2180130-2183186 45.3 1.3e-12 1
CR522870_1025 CDS_1164668-1162026 42.7 7.3e-12 1
CR522870_1256 CDS_1402703-1404799 41.3 1.7e-11 1
CR522870_3113 CDS_3517235-3515100 39.9 4.3e-11 1
CR522870_2891 CDS_3267729-3266230 39.9 4.4e-11 1
CR522870_1518 CDS_1686770-1689562 39.6 5.2e-11 1
CR522870_2883 CDS_3255537-3253996 37.0 3e-10 1
CR522870_0601 CDS_657779-659161 35.4 8.3e-10 1
CR522870_2391 CDS_2733039-2730148 35.0 1.1e-09 1
CR522870_0752 CDS_848005-850134 27.8 1.2e-07 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CR522870_0359 1/1 535 600 .. 1 87 [] 98.0 1.5e-27
CR522870_1886 1/1 373 440 .. 1 87 [] 90.5 2e-25
CR522870_1793 1/1 673 741 .. 1 87 [] 83.0 2.7e-23
CR522870_2292 1/1 513 579 .. 1 87 [] 78.8 4.2e-22
CR522870_0883 1/1 446 512 .. 1 87 [] 75.1 4.7e-21
CR522870_0954 1/1 178 253 .. 1 87 [] 61.0 4.8e-17
CR522870_2635 1/1 374 440 .. 1 87 [] 59.6 1.1e-16
CR522870_0375 1/1 343 409 .. 1 87 [] 57.4 4.7e-16
CR522870_2722 1/1 331 401 .. 1 87 [] 56.9 6.7e-16
CR522870_1041 1/1 257 319 .. 1 83 [. 47.6 3e-13
CR522870_1924 1/1 645 711 .. 1 87 [] 47.1 4.1e-13
CR522870_2822 1/1 531 602 .. 1 87 [] 46.7 5.4e-13
CR522870_1926 1/1 652 718 .. 1 87 [] 46.3 6.9e-13
CR522870_1925 1/1 649 715 .. 1 87 [] 45.3 1.3e-12
CR522870_1025 1/1 508 574 .. 1 87 [] 42.7 7.3e-12
CR522870_1256 1/1 323 389 .. 1 87 [] 41.3 1.7e-11
CR522870_3113 1/1 335 401 .. 1 87 [] 39.9 4.3e-11
CR522870_2891 1/1 283 348 .. 1 85 [. 39.9 4.4e-11
CR522870_1518 1/1 563 627 .. 1 87 [] 39.6 5.2e-11
CR522870_2883 1/1 144 214 .. 1 87 [] 37.0 3e-10
CR522870_0601 1/1 239 305 .. 1 87 [] 35.4 8.3e-10
CR522870_2391 1/1 589 653 .. 1 85 [. 35.0 1.1e-09
CR522870_0752 1/1 485 552 .. 1 87 [] 27.8 1.2e-07

Alignments of top-scoring domains:
CR522870_0359: domain 1 of 1, from 535 to 600: score 98.0, E = 1.5e-27
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks f+an+sHE+RTPL++++g+a+lL++ t ls +q
CR522870_0 535 AKSTFVANMSHEIRTPLNGVLGLAQLLEK---------TSLSVDQ-- 570

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r y+++il+++++ll +nd+Ld++++eag
CR522870_0 571 ----------RSYVRRILDSGQQLLTTVNDILDFAKMEAG 600

CR522870_1886: domain 1 of 1, from 373 to 440: score 90.5, E = 2e-25
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++f+an+sHELRTP+taIrgy+e+Ll+ ++l+ ++ +
CR522870_1 373 VRRDFVANVSHELRTPITAIRGYVETLLD---------GALDQKEDA 410

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r++l ++lr++ rl+++indlL lsrie
CR522870_1 411 ----------RRFLAIVLRQSSRLSDIINDLLALSRIELD 440

CR522870_1793: domain 1 of 1, from 673 to 741: score 83.0, E = 2.7e-23
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
kseflan+sHELRTPL++I+ +++lL + + ++ls++q
CR522870_1 673 YKSEFLANMSHELRTPLNSILILSQLLST------NKAGNLSDKQ-- 711

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e i++++ ll+Lind+Ldls+ eag
CR522870_1 712 ----------VESAGAIHSSGAELLNLINDILDLSKVEAG 741

CR522870_2292: domain 1 of 1, from 513 to 579: score 78.8, E = 4.2e-22
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks flan+sHE+RTP+++++g++++ le + l ++
CR522870_2 513 AKSAFLANMSHEIRTPMNSVLGFIQITLE---------SRLLCAEL- 549

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+ let++++a+ ll +ind+Ld s++e+g
CR522870_2 550 ----------RRHLETAYSSAKGLLIIINDILDVSKLESG 579

CR522870_0883: domain 1 of 1, from 446 to 512: score 75.1, E = 4.7e-21
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak flan+sHE+RTP++aI+g++ + le ++ l+++
CR522870_0 446 AKAIFLANMSHEIRTPMNAILGFLAIVLE--------SSSLPADL-- 482

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+ + t++ +ae+ll +ind+Ld s+ ++g
CR522870_0 483 ----------RKHIVTAHGSAESLLVIINDVLDVSKFDSG 512

CR522870_0954: domain 1 of 1, from 178 to 253: score 61.0, E = 4.8e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ ++a+++HE+++PLt+I+g+a+ L+++++k+ ++ ++ +
CR522870_0 178 TVGTLAAGIAHEINNPLTSISGFAQGLQRRVNKLVGRVEDELVAD-- 222

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ ey+eti+ e r+++++ lL++sr +
CR522870_0 223 ---------FDEYTETIITECLRCRDIVKTLLTFSRPLES 253

CR522870_2635: domain 1 of 1, from 374 to 440: score 59.6, E = 1.1e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++++a+++HELR+PL++I+g+ lL ++ + +++
CR522870_2 374 SLGKMAAGVAHELRNPLSSIKGLGMLLHSFF--------AGGSKG-- 410

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ +++ +e+erl+r i +lLd+++ e++
CR522870_2 411 ----------QQTAQVLVDEVERLNRSITELLDYAKPEEE 440

CR522870_0375: domain 1 of 1, from 343 to 409: score 57.4, E = 4.7e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a+++++++++HE+R+PL ++rg+a + + ++see+
CR522870_0 343 ALGKMASGIAHEIRNPLGTLRGFAYFFGK--------SNNASEET-- 379

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ey + + e++rl+r+++ lL++sr +++
CR522870_0 380 ----------KEYSQLMVAEIDRLNRIVSGLLQFSRPREP 409

CR522870_2722: domain 1 of 1, from 331 to 401: score 56.9, E = 6.7e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkv.lagdtelseeqr
a + + a+++HE+R+PLtaI+g a++L+e+l ++ag+t+ s
CR522870_2 331 AIGTMSASIAHEFRNPLTAISGSAQILEEDL--InQAGETTIS---- 371

lpeLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e+ +ilre++rll+ i+++L +++ e+
CR522870_2 372 -----------YELCAIILRESDRLLETISNFLIFAKPEHS 401

CR522870_1041: domain 1 of 1, from 257 to 319: score 47.6, E = 3e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ ++a ++HEL TPL+++ g a+++ + +el+++++
CR522870_1 257 TFGLLAAEIAHELGTPLNVVDGRAKMIIR---------EELNPQEI- 293

peLRledpeyreyletilreaerllrLindlLdlsr<-*
+e +i++++er+ +i++lL+++r
CR522870_1 294 ----------KECATIIKSQSERMAVIIRQLLEFTR 319

CR522870_1924: domain 1 of 1, from 645 to 711: score 47.1, E = 4.1e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a + ++ +++H++++ L++I+gyael+++ e ++ +
CR522870_1 645 AIGALAGGIAHDFNNILAVILGYAELAKD----------EIPANSI- 680

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ e l+ +++ ++r +L+ ++L +sr e
CR522870_1 681 ---------IGEDLDQVIEGGNRAKELVKQILAFSRQEKV 711

CR522870_2822: domain 1 of 1, from 531 to 602: score 46.7, E = 5.4e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a +e ++ ++HE+++PLt I++ a+ L++++ +e e++
CR522870_2 531 AWREVARRIAHEIKNPLTPIQLSAQRLRRRY-------PEILKEEN- 569

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ + ++ti+++++ l L++++ +++r+
CR522870_2 570 -------SIFDQCTSTIISQVDELKTLVSEFSQFARMPKI 602

CR522870_1926: domain 1 of 1, from 652 to 718: score 46.3, E = 6.9e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a + ++ +++H++++ L++I+gyael+++ ++++++
CR522870_1 652 AIGTLAGGIAHDFNNILAVILGYAELAKD--------EAPANSVI-- 688

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ l+ ++ ++r +L+ ++L +sr e
CR522870_1 689 ----------EKDLDQVIVGGNRAKELVKQILAFSRQEKV 718

CR522870_1925: domain 1 of 1, from 649 to 715: score 45.3, E = 1.3e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a + ++ +++H++++ L++I+gyael+++e+ ++++
CR522870_1 649 AIGTLAGGIAHDFNNILAVILGYAELAKDEV--------PANSVI-- 685

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ l+ ++ ++r +L+ ++L +sr e
CR522870_1 686 ----------EKDLDQVIVGGNRAKELVKQILAFSRQEKV 715

CR522870_1025: domain 1 of 1, from 508 to 574: score 42.7, E = 7.3e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a + ++ ++sH++++ Lt+I+ +el+ + + e +
CR522870_1 508 AVGTLVGGISHDFNNILTSIMNSVELAIT----------DIEKESMT 544

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
l++++++a r +rL+ ++L++sr+ ++
CR522870_1 545 ----------WTDLDRARKAAYRGSRLVKQILTFSRLSQE 574

CR522870_1256: domain 1 of 1, from 323 to 389: score 41.3, E = 1.7e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ ++ +++HEL++ L+++ gy++lLl el + ++++
CR522870_1 323 ELGLMTGGAAHELKNILSGVVGYSDLLLIEL--------ASDAKE-- 359

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r + i+ ++ + +L++dlL+ r + g
CR522870_1 360 ----------RSVVAAIKTAGLQAANLVSDLLTVVRGGGG 389

CR522870_3113: domain 1 of 1, from 335 to 401: score 39.9, E = 4.3e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a ++ +++H++++ L+aI gy++l l +++s++
CR522870_3 335 AIATLAGGIAHDFNNILSAIVGYTDLSLF--------TETCSDDV-- 371

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r le +++++er ++L++++L l+r+e+
CR522870_3 372 ----------RSNLEQVQKASERARNLVRQILSLTRAETS 401

CR522870_2891: domain 1 of 1, from 283 to 348: score 39.9, E = 4.4e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ ++a++sHE++ PL +r +aelL+++ + +
CR522870_2 283 HLGTMVATVSHEIKSPLGIVRSTAELLQKRI-------KKIAPGN-- 320

peLRledpeyreyletilreaerllrLindlLdlsrie<-*
+ + +i++e+ rl++++ ++Ld++r +
CR522870_2 321 ----------EMLAGIIIDETTRLNDIVIEFLDFARPQ 348

CR522870_1518: domain 1 of 1, from 563 to 627: score 39.6, E = 5.2e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a + ++ +++H++++ L+aI+gyael++ ++ +ls+ +
CR522870_1 563 AIGTLAGGIAHDFNNVLAAILGYAELAKLNA--------PLSSTHE- 600

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
le i+++++r L++++Ld+sr
CR522870_1 601 -------------LEQIIKASNRAKVLVRQILDFSRQADI 627

CR522870_2883: domain 1 of 1, from 144 to 214: score 37.0, E = 3e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a + ++ +++H++++ Lt I+gy+e+++ +++ +++ l++
CR522870_2 144 AIGTLAGGVAHDFNNVLTPILGYSEIIRLRME----QEGLLDSAM-- 184

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
yl il++a r ++L++++L++s ++
CR522870_2 185 ----------DGYLGEILSAAGRAQKLVEQILTFSCSAEQ 214

CR522870_0601: domain 1 of 1, from 239 to 305: score 35.4, E = 8.3e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ l n++H+LRTP++ +r +ae l + + + +
CR522870_0 239 ELQGSLDNVAHDLRTPIARLRSTAEYGLQ---------GGNDLPRL- 275

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++l l+e+e+++++++ ++ + +e+g
CR522870_0 276 ----------QDALANCLEESEQISAILRIMMSVAEAESG 305

CR522870_2391: domain 1 of 1, from 589 to 653: score 35.0, E = 1.1e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ ++ +++H++++ L++I+g+ae+++e d +++ + +
CR522870_2 589 TVGAMAGGIAHDFNNILAVILGNAEMARE--------DIPAGNPAI- 626

peLRledpeyreyletilreaerllrLindlLdlsrie<-*
++ +l+++er +Li ++L +sr e
CR522870_2 627 -----------ANIDEVLKASERAKSLIKQILSFSRKE 653

CR522870_0752: domain 1 of 1, from 485 to 552: score 27.8, E = 1.2e-07
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++++ nl HE+RTPL+a ++ ++ L +el ++ + +
CR522870_0 485 YREKMADNLEHEMRTPLAAASASLQNLDREL--------VAPGKRI- 522

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ yl+ ++ ++ r+++L+ ++d + ++
CR522870_0 523 ----------QNYLDWAILDIARMDNLLTVIRDATSLQDA 552


Histogram of all scores:
score obs exp (one = represents 10 sequences)
----- --- ---
-15 1 0|=
-14 18 0|==
-13 47 2|*====
-12 157 71|=======*========
-11 349 369|=================================== *
-10 558 685|======================================================== *
-9 560 708|======================================================== *
-8 507 530|=================================================== *
-7 365 334|=================================*===
-6 215 192|===================*==
-5 150 105|==========*====
-4 66 56|=====*=
-3 41 29|==*==
-2 28 15|=*=
-1 11 8|*=
0 7 4|*
1 4 2|*
2 2 1|*
3 5 0|=
4 0 0|
5 0 0|
> 6 27 -|===


% Statistical details of theoretical EVD fit:
mu = -8.9758
lambda = 0.6525
chi-sq statistic = 200.9174
P(chi-square) = 4.799e-37

Total sequences searched: 3118

Whole sequence top hits:
tophits_s report:
Total hits: 23
Satisfying E cutoff: 23
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 23
Satisfying E cutoff: 23
Total memory: 30K


Acknowledgements:

This research is funded by:

Developed by: