Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

2 accessions found for Corynebacterium jeikeium K411  

Data for CR931997  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CR931997.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CR931997_1656 CDS_1935269-1934052 92.1 3.9e-27 1
CR931997_0888 CDS_1063531-1062404 77.4 8.5e-23 1
CR931997_1162 CDS_1363767-1362673 73.5 1.1e-21 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CR931997_1656 1/1 202 269 .. 1 70 [] 92.1 3.9e-27
CR931997_0888 1/1 178 245 .. 1 70 [] 77.4 8.5e-23
CR931997_1162 1/1 163 228 .. 1 70 [] 73.5 1.1e-21

Alignments of top-scoring domains:
CR931997_1656: domain 1 of 1, from 202 to 269: score 92.1, E = 3.9e-27
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD v++sL++++ q+++ r++ +kdp++a eald+i
CR931997_1 202 ERNRIARELHDIVAHSLTVVIAQADGGRYAG--RKDPDKAIEALDTI 246

relarealaevRrllgdLRpaal<-*
++ +r al+++R+ll++L+++a
CR931997_1 247 AARGRSALTQMRELLSVLHDDAP 269

CR931997_0888: domain 1 of 1, from 178 to 245: score 77.4, E = 8.5e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+ IA + HD +g+sL++i+l++e+arr++ d +pe+a+++l+ei
CR931997_0 178 QREDIATDVHDLLGHSLTVINLKSEVARRAM--DNNPEQAKQELKEI 222

relarealaevRrllgdLRpaal<-*
+l+r alaevR +++++R++++
CR931997_0 223 SDLSRLALAEVRSTVTRMRTPTF 245

CR931997_1162: domain 1 of 1, from 163 to 228: score 73.5, E = 1.1e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+A E+HD+++Q+Ls+i + l+++++++ +++ e+ e l+ +
CR931997_1 163 ERTRLAGEIHDTIAQGLSSIHMILQAVEKRV--EDP--EVLEDLRLA 205

relarealaevRrllgdLRpaal<-*
r++a++ lae+Rr++ +L+p+ l
CR931997_1 206 RTTAEDNLAETRRIIAALQPGPL 228


Histogram of all scores:
score obs exp (one = represents 7 sequences)
----- --- ---
-15 1 0|=
-14 1 0|=
-13 25 0|====
-12 60 23|===*=====
-11 82 192|============ *
-10 247 447|==================================== *
-9 385 508|======================================================= *
-8 293 391|========================================== *
-7 305 246|===================================*========
-6 215 139|===================*===========
-5 214 74|==========*====================
-4 117 38|=====*===========
-3 64 20|==*=======
-2 38 10|=*====
-1 27 5|*===
0 9 2|*=
1 5 1|*
2 5 0|=
3 1 0|=
4 2 0|=
5 1 0|=
> 6 7 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 997.5927
P(chi-square) = 0

Total sequences searched: 2104

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: