Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Frankia alni ACN14a  

Data for CT573213  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CT573213.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CT573213_4633 CDS_5127159-5125939 87.2 3.4e-25 1
CT573213_4708 CDS_5212760-5214172 85.5 1e-24 1
CT573213_2905 CDS_3249642-3251177 84.6 2e-24 1
CT573213_0650 CDS_728299-726773 70.3 3.3e-20 1
CT573213_0513 CDS_586778-585024 63.7 2.8e-18 1
CT573213_2224 CDS_2495474-2497204 59.6 4.7e-17 1
CT573213_1914 CDS_2143398-2142292 54.9 1.1e-15 1
CT573213_0111 CDS_116932-115166 52.3 6.6e-15 1
CT573213_4047 CDS_4468558-4467485 46.4 3.7e-13 1
CT573213_4645 CDS_5141020-5142789 44.7 1.1e-12 1
CT573213_0799 CDS_891168-889390 39.2 4.9e-11 1
CT573213_2425 CDS_2719146-2716954 35.6 5.6e-10 1
CT573213_5391 CDS_5968878-5967550 35.1 7.5e-10 1
CT573213_2911 CDS_3257493-3255601 33.1 3.1e-09 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CT573213_4633 1/1 164 231 .. 1 70 [] 87.2 3.4e-25
CT573213_4708 1/1 217 284 .. 1 70 [] 85.5 1e-24
CT573213_2905 1/1 238 305 .. 1 70 [] 84.6 2e-24
CT573213_0650 1/1 180 247 .. 1 70 [] 70.3 3.3e-20
CT573213_0513 1/1 272 337 .. 1 70 [] 63.7 2.8e-18
CT573213_2224 1/1 365 429 .. 1 70 [] 59.6 4.7e-17
CT573213_1914 1/1 168 235 .. 1 70 [] 54.9 1.1e-15
CT573213_0111 1/1 403 468 .. 1 70 [] 52.3 6.6e-15
CT573213_4047 1/1 163 230 .. 1 70 [] 46.4 3.7e-13
CT573213_4645 1/1 394 459 .. 1 70 [] 44.7 1.1e-12
CT573213_0799 1/1 377 445 .. 1 70 [] 39.2 4.9e-11
CT573213_2425 1/1 476 541 .. 1 70 [] 35.6 5.6e-10
CT573213_5391 1/1 246 318 .. 1 70 [] 35.1 7.5e-10
CT573213_2911 1/1 397 469 .. 1 70 [] 33.1 3.1e-09

Alignments of top-scoring domains:
CT573213_4633: domain 1 of 1, from 164 to 231: score 87.2, E = 3.4e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARE+HD v++s s+i++q+ +a ++ d p++ar+al+ i
CT573213_4 164 ERARIAREIHDIVAHSVSVIIVQAAAADDVF--DIRPDQARRALRSI 208

relarealaevRrllgdLRpaal<-*
++++r+alae+Rrll + Rp+++
CT573213_4 209 ETTGRDALAELRRLLAVVRPGGE 231

CT573213_4708: domain 1 of 1, from 217 to 284: score 85.5, E = 1e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIAR+LHD +g++L+ i++++ela +l+ ++dp++a+++++e+
CT573213_4 217 ERLRIARDLHDLLGHALTTITVKAELASKLA--ERDPARAAREMAEV 261

relarealaevRrllgdLRpaal<-*
++l+r++la+vR+++ ++R+ l
CT573213_4 262 AALGRQGLADVRATVAGYREVSL 284

CT573213_2905: domain 1 of 1, from 238 to 305: score 84.6, E = 2e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARE+HD+v+++Ls+++ +++++ l d+dp+ea +a++++
CT573213_2 238 ERARIAREMHDVVAHNLSVMIALADGVAFTL--DTDPAEAGRAVQAV 282

relarealaevRrllgdLRpaal<-*
+++real e+Rrllg LR++a
CT573213_2 283 SDTGREALGEMRRLLGILRDDAQ 305

CT573213_0650: domain 1 of 1, from 180 to 247: score 70.3, E = 3.3e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+ARE HD+vg+sLs+i+lq+ +a+++l d+ pe+a+ al++i
CT573213_0 180 ERLRMAREVHDVVGHSLSVISLQAAVALHVL--DRRPEQAQVALEAI 224

relarealaevRrllgdLRpaal<-*
r+++ +al+e+R +l R ++
CT573213_0 225 RRTSVDALDELRSTLALTRAGQQ 247

CT573213_0513: domain 1 of 1, from 272 to 337: score 63.7, E = 2.8e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R AR+ HD+v+++Ls+i++ +++ar ll +dp eareal i
CT573213_0 272 ERLRVARDVHDVVSHTLSLIAVRSGVAR-LL---EDPREAREALSVI 314

relarealaevRrllgdLRpaal<-*
++++r al+evRr+l+ R ++
CT573213_0 315 ETTSRSALDEVRRVLRSTRQEIE 337

CT573213_2224: domain 1 of 1, from 365 to 429: score 59.6, E = 4.7e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIAR+LHD+v Q+L+a lq++ ++r+l +++a+ +l+++
CT573213_2 365 ERDRIARDLHDVVIQRLFATGLQMQSLARVL-----DGPAAGRLHAA 406

relarealaevRrllgdLRpaal<-*
++ +++++a++R+++ L a+l
CT573213_2 407 ADELDHTIADIRQTIFSLTVADL 429

CT573213_1914: domain 1 of 1, from 168 to 235: score 54.9, E = 1.1e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
+RI R+LHD+ +L a++++l+la+ l ++dp++a+ ++e+
CT573213_1 168 DLRRIERDLHDGAQARLVALAMGLGLAKEKL--ADDPDAAALMVAEA 212

relarealaevRrllgdLRpaal<-*
++ a+ al+e+R+l+++++pa+l
CT573213_1 213 HGEAKLALQELRDLARGIHPAIL 235

CT573213_0111: domain 1 of 1, from 403 to 468: score 52.3, E = 6.6e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ R+LHD+ Q+L a++ l+lar+ + +++ a++++
CT573213_0 403 ERRRLERDLHDGAQQRLLALATRLGLARTKA--TDP--DTISAIEAA 445

relarealaevRrllgdLRpaal<-*
re +r+ala++R l+++++pa+l
CT573213_0 446 REDLRHALADLRSLARGIHPAVL 468

CT573213_4047: domain 1 of 1, from 163 to 230: score 46.4, E = 3.7e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E aR R+LHD+ ++ +++l l++a+ l+ ++dpe+ ++ l+e+
CT573213_4 163 ELARVERDLHDGAQARMVSLALSLGMAEDLV--RADPEATARLLREA 207

relarealaevRrllgdLRpaal<-*
r +a al+++R + + ++pa+l
CT573213_4 208 RSTAVSALDDLRTVMHSIHPAVL 230

CT573213_4645: domain 1 of 1, from 394 to 459: score 44.7, E = 1.1e-12
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RIAR+LHD v Q+L+a++++l+++++ +++ + +e++ +
CT573213_4 394 DRDRIARDLHDHVMQRLFAVAMGLQGLAASE--ERA--ARAERMSTY 436

relarealaevRrllgdLRpaal<-*
e ++e+ +e+R+++ +LR a
CT573213_4 437 VEDLDETVREIRQTIFELRGRAT 459

CT573213_0799: domain 1 of 1, from 377 to 445: score 39.2, E = 4.9e-11
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+ + R+LHD+ Q+L +++l l +ar++l + ++ a++ l+ +
CT573213_0 377 ARRELERDLHDGAQQRLVVVALTLMRARHRLG-GTTDPGAAQLLADC 422

relarealaevRrllgdLRpaal<-*
++ ++ a+ e+R+l+++L+pa+l
CT573213_0 423 ADGLDAAIGELRELARGLHPAIL 445

CT573213_2425: domain 1 of 1, from 476 to 541: score 35.6, E = 5.6e-10
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ I R LHD+ Q+L a++lql +++ d++ +r+a+ +
CT573213_2 476 ERRTIERNLHDGAQQRLLALALQLRAVQLGG--DEA--SLRQAISTG 518

relarealaevRrllgdLRpaal<-*
+ ++ a e+R+l+ +L+pa+l
CT573213_2 519 IDQLQAAVVELRELANGLHPAVL 541

CT573213_5391: domain 1 of 1, from 246 to 318: score 35.1, E = 7.5e-10
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.....eare
+RI R+LHD+ +L a+++ l+ ar +l ++d + + + r+
CT573213_5 246 ALRRIERDLHDGAQVRLVAMAMNLGIAREHL--AADGDavdleTTRT 290

aldeirelarealaevRrllgdLRpaal<-*
+d++++ ++e l e+R+++++++p++l
CT573213_5 291 LVDAAHRDVKEVLVELRNIARGIHPPIL 318

CT573213_2911: domain 1 of 1, from 397 to 469: score 33.1, E = 3.1e-09
*->ERaRIARELHDsvgQsLsaiklqlelarrllds...dkdpeeareal
ER+RI R+LHD+ Q+L ai + l++ar+++ ++ ++++++a +
CT573213_2 397 ERRRIQRDLHDGAQQRLLAILVLLDGARHAMSHhaaADAAGRAFGLV 443

deirelarealaevRrllgdLRpaal<-*
+++++ + a+ ++R+l++++ p++l
CT573213_2 444 ERAHRELGVAIGQLRDLAQGIYPSIL 469


Histogram of all scores:
score obs exp (one = represents 17 sequences)
----- --- ---
-14 18 0|==
-13 70 0|=====
-12 171 74|====*======
-11 232 615|============== *
-10 665 1427|======================================== *
-9 952 1620|======================================================== *
-8 892 1249|===================================================== *
-7 957 785|==============================================*==========
-6 781 444|==========================*===================
-5 754 238|=============*===============================
-4 399 124|=======*================
-3 286 64|===*=============
-2 203 32|=*==========
-1 128 16|*=======
0 67 8|*===
1 40 4|*==
2 29 2|*=
3 13 1|*
4 13 0|=
5 9 0|=
6 7 0|=
7 2 0|=
8 1 0|=
9 2 0|=
10 0 0|
11 1 0|=
12 0 0|
13 0 0|
14 1 0|=
15 0 0|
16 1 0|=
> 17 17 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 5966.4819
P(chi-square) = 0

Total sequences searched: 6723

Whole sequence top hits:
tophits_s report:
Total hits: 14
Satisfying E cutoff: 14
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 14
Satisfying E cutoff: 14
Total memory: 25K


Acknowledgements:

This research is funded by:

Developed by: