Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
264 projects found  

1 accessions found for Pseudomonas entomophila L48  

Data for CT573326  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CT573326.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CT573326_3460 CDS_4017393-4018211 66.5 3.3e-19 1
CT573326_0393 CDS_460654-463041 62.1 6.7e-18 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CT573326_3460 1/1 61 125 .. 1 70 [] 66.5 3.3e-19
CT573326_0393 1/1 599 666 .. 1 70 [] 62.1 6.7e-18

Alignments of top-scoring domains:
CT573326_3460: domain 1 of 1, from 61 to 125: score 66.5, E = 3.3e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R++RELHD +gQ L+a+klq+++++r++ p e++++ ++
CT573326_3 61 ERQRLSRELHDDIGQLLTAAKLQVDWLHRRV-----PTELQAHCGTL 102

relarealaevRrllgdLRpaal<-*
r +++++l+ vR++ L p +l
CT573326_3 103 RSTLDHTLSNVRDVSAILNPRQL 125

CT573326_0393: domain 1 of 1, from 599 to 666: score 62.1, E = 6.7e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E aRIARE HD++gQ+L+++kl +++++ ++ + + + e+l+ +
CT573326_0 599 EKARIAREVHDELGQMLTVLKLEVSMCELAY--GELDTGLNERLASM 643

relarealaevRrllgdLRpaal<-*
++l+ + + vR+++++LRp++l
CT573326_0 644 KRLIAQLFQLVRDVATALRPPIL 666


Histogram of all scores:
score obs exp (one = represents 16 sequences)
----- --- ---
-14 11 0|=
-13 60 0|====
-12 121 57|===*====
-11 193 470|============= *
-10 584 1091|===================================== *
-9 894 1239|======================================================== *
-8 745 955|=============================================== *
-7 718 600|=====================================*=======
-6 588 340|=====================*===============
-5 507 182|===========*====================
-4 232 95|=====*=========
-3 165 48|==*========
-2 109 25|=*=====
-1 92 12|*=====
0 41 6|*==
1 25 3|*=
2 14 1|*
3 9 0|=
4 8 0|=
5 5 0|=
6 1 0|=
7 2 0|=
8 3 0|=
9 1 0|=
10 0 0|
11 2 0|=
12 0 0|
13 0 0|
14 1 0|=
15 0 0|
16 0 0|
> 17 3 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 2825.8887
P(chi-square) = 0

Total sequences searched: 5168

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: