Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

1 accessions found for Bradyrhizobium sp. ORS278  

Data for CU234118  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CU234118.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CU234118_1398 CDS_1588124-1589611 139.5 3.9e-47 1
CU234118_5899 CDS_6469581-6471269 128.0 3.3e-43 1
CU234118_2317 CDS_2630122-2628608 127.5 4.8e-43 1
CU234118_0987 CDS_1112674-1114329 126.5 1e-42 1
CU234118_1892 CDS_2132793-2135354 112.6 5.8e-38 1
CU234118_3731 CDS_4127448-4128983 106.7 5.9e-36 1
CU234118_4767 CDS_5235763-5233652 95.6 3.4e-32 1
CU234118_2152 CDS_2440278-2443454 94.7 7.3e-32 2
CU234118_0469 CDS_507480-506512 84.8 1.6e-28 1
CU234118_6493 CDS_7138704-7140086 80.2 6.2e-27 1
CU234118_5705 CDS_6247386-6248480 77.7 4.3e-26 1
CU234118_3249 CDS_3620697-3618589 68.5 5.8e-23 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CU234118_1398 1/1 295 376 .. 1 85 [] 139.5 3.9e-47
CU234118_5899 1/1 369 449 .. 1 85 [] 128.0 3.3e-43
CU234118_2317 1/1 314 394 .. 1 85 [] 127.5 4.8e-43
CU234118_0987 1/1 346 424 .. 1 85 [] 126.5 1e-42
CU234118_1892 1/1 520 602 .. 1 85 [] 112.6 5.8e-38
CU234118_3731 1/1 306 384 .. 1 85 [] 106.7 5.9e-36
CU234118_4767 1/1 514 592 .. 1 85 [] 95.6 3.4e-32
CU234118_2152 2/2 859 941 .. 1 85 [] 93.7 1.5e-31
CU234118_0469 1/1 144 220 .. 1 85 [] 84.8 1.6e-28
CU234118_6493 1/1 268 348 .. 1 85 [] 80.2 6.2e-27
CU234118_5705 1/1 183 262 .. 1 85 [] 77.7 4.3e-26
CU234118_3249 1/1 509 591 .. 1 85 [] 68.5 5.8e-23

Alignments of top-scoring domains:
CU234118_1398: domain 1 of 1, from 295 to 376: score 139.5, E = 3.9e-47
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKN+LA+VQS+a QTlR+++sl++f+ aFsgR+qA s aHd+
CU234118_1 295 ELNHRVKNILAIVQSVAGQTLRTSPSLPAFNKAFSGRIQAVSIAHDI 341

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt+++W g + eLl+ LaPyg +++Ri ++GP+
CU234118_1 342 --LTQTRWIGIGFNELLTTVLAPYGV-GEGRIAIEGPP 376

CU234118_5899: domain 1 of 1, from 369 to 449: score 128.0, E = 3.3e-43
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E nHRVKNtL +VQSiar ++ +a +++++v+a++gR+ ALs+a +L
CU234118_5 369 EINHRVKNTLGTVQSIARLSRSSASDVNDYVAALEGRILALSEAYNL 415

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt+ +W gAd ++++ ++LaPy+g ++R+t+sGP+
CU234118_5 416 --LTENNWVGADVGAIVDRTLAPYAG--PDRLTISGPS 449

CU234118_2317: domain 1 of 1, from 314 to 394: score 127.5, E = 4.8e-43
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA+ Q+ia QT+R + +e+F+gRL AL++aH+L
CU234118_2 314 ELNHRVKNTLAILQAIAVQTFR--SASRYEREKFEGRLGALAEAHNL 358

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L+ + W+g +L +++ + L Py+ + +eRi++sGP
CU234118_2 359 --LSKEKWQGSELEDVIGRVLKPYRLNNPERIRISGPK 394

CU234118_0987: domain 1 of 1, from 346 to 424: score 126.5, E = 1e-42
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKN+LAv+QSi++ TlR+ ++d ++e ++gR++A+s++ L
CU234118_0 346 ELNHRVKNILAVIQSIVTRTLRHGSDIDVARELLIGRIHAMSNVVTL 392

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L++s+W+g+ Lr L ea P+ aeRi +sGPd
CU234118_0 393 --LSESQWQGVQLRGLFEARAIPH----AERIAVSGPD 424

CU234118_1892: domain 1 of 1, from 520 to 602: score 112.6, E = 5.8e-38
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRV+N+L++V ++++Q+ +a+s++ef+ + gR+qAL+raHd+
CU234118_1 520 ELNHRVRNILSLVRGLVAQSKDTATSVEEFASVLGGRIQALARAHDQ 566

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+t +Wa++ Lr Lle+e ++y g+ a+R++++GPd
CU234118_1 567 --ITNLNWAPVALRSLLESEAGAYLGARAGRVRMEGPD 602

CU234118_3731: domain 1 of 1, from 306 to 384: score 106.7, E = 5.9e-36
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E++HR KN L++ QSi+r T a+s+ +v a++gR+ AL+r+H +
CU234118_3 306 EVDHRAKNALTLAQSIVRLT--KADSVRTYVSAVEGRISALARVHTI 350

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L+ s+W+gA+++ L+++eLaPy++ ++++ +sG +
CU234118_3 351 --LSLSSWQGAEIGRLVSEELAPYAT--GGQVAFSGAE 384

CU234118_4767: domain 1 of 1, from 514 to 592: score 95.6, E = 3.4e-32
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL HRVKN+LAvVQS+a+Q l +++ + v++F+ RL+AL+ +H
CU234118_4 514 ELAHRVKNSLAVVQSLAHQLLPRHDVK---VRDFTSRLHALATVHTS 557

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L + +W+gAdL++L+++++aP+++ ++++ lsGP+
CU234118_4 558 --LAENDWQGADLAALITSQVAPFAST-PDQLALSGPT 592

CU234118_2152: domain 2 of 2, from 859 to 941: score 93.7, E = 1.5e-31
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRV+NtL vV Siar +++++ +++e+++ ++gRL AL+r++
CU234118_2 859 ELQHRVRNTLGVVRSIARRSAQTSSTVEEYAAHLDGRLGALARTQAA 905

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+tr+ ag+dL Ll+ eL +y + +e++++sGP+
CU234118_2 906 --VTRDPQAGVDLEYLLADELMAYKAREGEQVRISGPS 941

CU234118_0469: domain 1 of 1, from 144 to 220: score 84.8, E = 1.6e-28
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR KN ++++++ +Q l+ + ++ ++++++R++AL+ a dL
CU234118_0 144 ELHHRLKNKTSTIHAVLHQVLH---DQPQVWGRIDQRIRALATADDL 187

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+ r++++g+dL++Ll +eL+Pyg + R++l G++
CU234118_0 188 --IARADGQGCDLKDLLMSELGPYG---HVRFELNGDS 220

CU234118_6493: domain 1 of 1, from 268 to 348: score 80.2, E = 6.2e-27
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E+nHR+KN L++VQ+iarQ R+ + ld +F +RLqA ++ +dL
CU234118_6 268 EVNHRSKNMLSLVQAIARQMTRHGRQLDL--NRFLARLQAIAGNQDL 312

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L + +W+ L +L++++L+++++ + Ri ++GP+
CU234118_6 313 --LIQNDWRFIPLVDLVRSQLGAFRDLIGNRIAIDGPQ 348

CU234118_5705: domain 1 of 1, from 183 to 262: score 77.7, E = 4.3e-26
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA+V S+++ + R + l+ef e ++ R++AL r+H L
CU234118_5 183 ELNHRVKNTLALVDSVIALSIRADPGLAEFGEVLRSRIAALTRSHAL 229

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
++ + L eL++aeLaP ++R+ + GP+
CU234118_5 230 --ALDRGREAIGLDELVRAELAPLQ---SDRVAVVGPA 262

CU234118_3249: domain 1 of 1, from 509 to 591: score 68.5, E = 5.8e-23
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRV+N LAv+ Si+r T +++s ++f+ ++gR++ALsr + +
CU234118_3 509 ELQHRVRNMLAVIRSIIRRTGESSESAEDFASHLEGRIAALSRIQAV 555

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+tr+ ag dL eL++ eL++ ++ +++ lsGP+
CU234118_3 556 --VTRDPLAGFDLTELIADELRAGAAREDRQYSLSGPA 591


Histogram of all scores:
score obs exp (one = represents 21 sequences)
----- --- ---
-17 1 0|=
-16 0 0|
-15 2 0|=
-14 22 0|==
-13 99 0|=====
-12 529 0|==========================
-11 596 54|==*==========================
-10 1014 694|=================================*===============
-9 1165 1719|======================================================== *
-8 1224 1784|==========================================================*
-7 819 1198|======================================= *
-6 474 654|======================= *
-5 343 324|===============*=
-4 180 153|=======*=
-3 103 71|===*=
-2 68 32|=*==
-1 30 15|*=
0 13 6|*
1 7 3|*
2 9 1|*
3 1 0|=
4 0 0|
5 3 0|=
> 6 15 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 6083.4370
P(chi-square) = 0

Total sequences searched: 6752

Whole sequence top hits:
tophits_s report:
Total hits: 12
Satisfying E cutoff: 12
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 12
Satisfying E cutoff: 12
Total memory: 25K


Acknowledgements:

This research is funded by:

Developed by: