Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

2 accessions found for Mycobacterium abscessus ATCC 19977  

Data for CU458896  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CU458896.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CU458896_1504 CDS_1541739-1542956 61.1 1.2e-17 1
CU458896_3861 CDS_3945271-3943568 43.4 2.1e-12 1
CU458896_4465 CDS_4575046-4576539 41.9 5.5e-12 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CU458896_1504 1/1 184 253 .. 1 70 [] 61.1 1.2e-17
CU458896_3861 1/1 379 444 .. 1 70 [] 43.4 2.1e-12
CU458896_4465 1/1 306 373 .. 1 70 [] 41.9 5.5e-12

Alignments of top-scoring domains:
CU458896_1504: domain 1 of 1, from 184 to 253: score 61.1, E = 1.2e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrllds.dkdpeearealde
ER+RIARE+HD++++sLs+ +l+l +arr+l ++d d + a + l
CU458896_1 184 ERRRIAREIHDVIAHSLSVTMLHLTGARRAL-QeDHDVDDAVAGLVD 229

irelarealaevRrllgdLRpaal<-*
+++l+r+a++++R ++g L +
CU458896_1 230 AERLGRQAMSDIRGTVGLLSAGPG 253

CU458896_3861: domain 1 of 1, from 379 to 444: score 43.4, E = 2.1e-12
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RIAR+LHD v Q+L+a+ l ++ +r+ ++ ++++l+
CU458896_3 379 DRDRIARDLHDHVIQRLFAVGLAMQSTHRRS--VDP--TVAARLADH 421

relarealaevRrllgdLRpaal<-*
+ ++e ++e+R ++ dL++ ++
CU458896_3 422 IDQLHEVIQEIRTAIFDLHTNDE 444

CU458896_4465: domain 1 of 1, from 306 to 373: score 41.9, E = 5.5e-12
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+R+ R+LHD+ Q+L+ ++l+l+++r+++ ++ ++e+ ++l ++
CU458896_4 306 ARRRLERDLHDGAQQRLAYLRLKLGMVRAAV--PATDAELTQELNNL 350

relarealaevRrllgdLRpaal<-*
+ + +e+ + ++L+pa+l
CU458896_4 351 DTDLTAVTRELQEFSRGLHPAIL 373


Histogram of all scores:
score obs exp (one = represents 15 sequences)
----- --- ---
-14 7 0|=
-13 56 0|====
-12 115 54|===*====
-11 197 450|============== *
-10 555 1046|===================================== *
-9 873 1188|==========================================================*
-8 766 915|==================================================== *
-7 661 575|======================================*======
-6 554 325|=====================*===============
-5 484 174|===========*=====================
-4 254 91|======*==========
-3 164 46|===*=======
-2 97 23|=*=====
-1 55 12|*===
0 31 6|*==
1 19 3|*=
2 10 1|*
3 7 0|=
4 1 0|=
5 1 0|=
> 6 13 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 2321.1541
P(chi-square) = 0

Total sequences searched: 4920

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: