hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CU468135.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CU468135_0524 CDS_588789-590273 79.2 4.1e-23 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CU468135_0524 1/1 287 354 .. 1 70 [] 79.2 4.1e-23
Alignments of top-scoring domains:
CU468135_0524: domain 1 of 1, from 287 to 354: score 79.2, E = 4.1e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD++gQ+L++++++++++r ++ kd++ + e++ +
CU468135_0 287 ERKRIAREIHDELGQHLTSLRMGISMLRIQF--SKDNPLLHERVVHL 331
relarealaevRrllgdLRpaal<-*
++l +++++ vR+++++LRp +l
CU468135_0 332 MGLTDKTIQVVRNVATRLRPNVL 354
Histogram of all scores:
score obs exp (one = represents 12 sequences)
----- --- ---
-15 1 0|=
-14 12 0|=
-13 78 0|=======
-12 125 38|===*=======
-11 210 314|================== *
-10 486 728|========================================= *
-9 673 827|========================================================= *
-8 534 637|============================================= *
-7 430 401|=================================*==
-6 302 226|==================*=======
-5 258 121|==========*===========
-4 127 63|=====*=====
-3 77 32|==*====
-2 43 16|=*==
-1 33 8|*==
0 21 4|*=
1 7 2|*
2 4 1|*
3 2 0|=
> 4 4 -|=
% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 772.5817
P(chi-square) = 0
Total sequences searched: 3484
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K