hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CU633749.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CU633749_0098 CDS_97373-95970 64.6 1.3e-19 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CU633749_0098 1/1 249 316 .. 1 70 [] 64.6 1.3e-19
Alignments of top-scoring domains:
CU633749_0098: domain 1 of 1, from 249 to 316: score 64.6, E = 1.3e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +R+ARELHD++g L+aikl l+++rr + ++d + a+e+l+++
CU633749_0 249 EKTRLARELHDELGAILTAIKLDLHWVRRKV--QADHPVAAERLTRV 293
relarealaevRrllgdLRpaal<-*
+ +++++++ Rrl+ dLRp++l
CU633749_0 294 MLHVDQGIQIKRRLIEDLRPTVL 316
Histogram of all scores:
score obs exp (one = represents 2 sequences)
----- --- ---
-13 4 0|==
-12 8 5|==*=
-11 20 48|========== *
-10 41 112|===================== *
-9 98 128|================================================= *
-8 74 98|===================================== *
-7 74 62|==============================*======
-6 74 35|=================*===================
-5 55 18|========*===================
-4 27 9|====*=========
-3 20 5|==*=======
-2 9 2|*====
-1 13 1|*======
0 3 0|==
1 4 0|==
2 0 0|
3 1 0|=
4 1 0|=
5 1 0|=
6 0 0|
7 1 0|=
> 8 3 -|==
% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 265.1309
P(chi-square) = 0
Total sequences searched: 533
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K