Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
264 projects found  

1 accessions found for Pseudomonas aeruginosa LESB58  

Data for FM209186  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: FM209186.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
FM209186_1100 CDS_1191288-1189420 77.6 2.1e-22 1
FM209186_0597 CDS_651460-653853 67.2 2.4e-19 1
FM209186_3343 CDS_3700601-3699951 39.7 3.1e-11 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
FM209186_1100 1/1 411 481 .. 1 70 [] 77.6 2.1e-22
FM209186_0597 1/1 596 663 .. 1 70 [] 67.2 2.4e-19
FM209186_3343 1/1 22 85 .. 1 70 [] 39.7 3.1e-11

Alignments of top-scoring domains:
FM209186_1100: domain 1 of 1, from 411 to 481: score 77.6, E = 2.1e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
ER IARELHDs++QsLs +k+q++++ +ll +++++ ++++++ld
FM209186_1 411 ERGTIARELHDSLAQSLSYLKIQVSRLGTLL--KREAPaeKIEDTLD 455

eirelarealaevRrllgdLR.paal<-*
e+re ++ a++++R+ll+++R ++
FM209186_1 456 ELREGLNGAYRQLRELLTTFRlSLDE 481

FM209186_0597: domain 1 of 1, from 596 to 663: score 67.2, E = 2.4e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E aRIARE HD++gQ L+++kl +++++ ++ +++ e +re+l ++
FM209186_0 596 EKARIAREVHDELGQVLTVLKLETSMCELAY--ADAQEGLRERLGNM 640

relarealaevRrllgdLRpaal<-*
++l+ + + vR+++++LRp++l
FM209186_0 641 KKLIAQLFQLVRDVATALRPPIL 663

FM209186_3343: domain 1 of 1, from 22 to 85: score 39.7, E = 3.1e-11
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ +A+ HD +gQ L++i+ ql l+r + + al+++
FM209186_3 22 ERRLLAQAVHDDIGQYLTGIRTQLLLLRCTA--G----DGQPALARL 62

relarealaevRrllgdLRpaal<-*
++ ++ + R+ll++L p+al
FM209186_3 63 ERYCQGLDDSFRALLRGLPPPAL 85


Histogram of all scores:
score obs exp (one = represents 16 sequences)
----- --- ---
-14 8 0|=
-13 46 0|===
-12 108 66|====*==
-11 188 543|============ *
-10 612 1261|======================================= *
-9 903 1432|========================================================= *
-8 846 1103|===================================================== *
-7 794 694|===========================================*======
-6 704 392|========================*===================
-5 688 210|=============*=============================
-4 367 109|======*================
-3 240 56|===*===========
-2 153 28|=*========
-1 92 14|*=====
0 64 7|*===
1 37 3|*==
2 35 1|*==
3 19 0|==
4 9 0|=
5 3 0|=
6 4 0|=
7 1 0|=
8 2 0|=
9 3 0|=
10 1 0|=
11 0 0|
12 0 0|
> 13 4 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 4753.0908
P(chi-square) = 0

Total sequences searched: 5965

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: