hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: FN543093.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
FN543093_2404 CDS_2519031-2520734 83.7 2.2e-24 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
FN543093_2404 1/1 355 422 .. 1 70 [] 83.7 2.2e-24
Alignments of top-scoring domains:
FN543093_2404: domain 1 of 1, from 355 to 422: score 83.7, E = 2.2e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa IARELHDs++QsLs +k+q++ ++++ d+ pee re l +i
FN543093_2 355 ERAAIARELHDSIAQSLSCMKMQVSCLQMQG--DALPEESRELLGQI 399
relarealaevRrllgdLRpaal<-*
r+ ++ + +++R+ll+++R +
FN543093_2 400 RHELNASWRQLRELLTTFRLQLN 422
Histogram of all scores:
score obs exp (one = represents 13 sequences)
----- --- ---
-15 1 0|=
-14 44 0|====
-13 114 0|=========
-12 165 47|===*=========
-11 252 386|==================== *
-10 602 895|=============================================== *
-9 764 1017|==========================================================*
-8 639 784|================================================== *
-7 512 492|=====================================*==
-6 397 279|=====================*=========
-5 324 149|===========*=============
-4 159 78|=====*=======
-3 95 40|===*====
-2 53 20|=*===
-1 39 10|*==
0 22 5|*=
1 11 2|*
2 11 1|*
3 2 0|=
4 2 0|=
5 3 0|=
6 0 0|
7 0 0|
> 8 2 -|=
% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1122.6810
P(chi-square) = 0
Total sequences searched: 4213
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K