Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Streptomyces scabiei 87.22  

Data for FN554889  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: FN554889.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
FN554889_3814 CDS_4452562-4451360 102.5 1.4e-29 1
FN554889_0108 CDS_118013-116778 98.1 2.8e-28 1
FN554889_6490 CDS_7436699-7437961 93.4 6.6e-27 1
FN554889_4050 CDS_4740349-4738967 91.5 2.3e-26 1
FN554889_3004 CDS_3550056-3548878 90.6 4.4e-26 1
FN554889_4048 CDS_4738169-4736820 87.7 3.1e-25 1
FN554889_0573 CDS_682201-681137 86.8 5.8e-25 1
FN554889_5224 CDS_6016109-6017452 85.6 1.3e-24 1
FN554889_8563 CDS_9877595-9876417 85.3 1.6e-24 1
FN554889_4205 CDS_4902666-4903874 81.8 1.8e-23 1
FN554889_0731 CDS_869347-868205 80.3 4.9e-23 1
FN554889_6330 CDS_7247890-7246739 80.0 5.8e-23 1
FN554889_6376 CDS_7314025-7312745 79.1 1.1e-22 1
FN554889_1677 CDS_2001665-2002924 79.0 1.2e-22 1
FN554889_6910 CDS_7905868-7907013 78.5 1.6e-22 1
FN554889_0845 CDS_1012488-1011247 77.7 2.8e-22 1
FN554889_7789 CDS_8935058-8936356 77.1 4.3e-22 1
FN554889_6099 CDS_6995870-6994617 76.3 7.1e-22 1
FN554889_1356 CDS_1604154-1603147 76.2 7.8e-22 1
FN554889_2657 CDS_3171982-3170717 75.2 1.5e-21 1
FN554889_4600 CDS_5353533-5352205 70.7 3.4e-20 1
FN554889_8335 CDS_9633445-9634542 70.2 4.5e-20 1
FN554889_2741 CDS_3272306-3273493 70.0 5.2e-20 1
FN554889_0528 CDS_627067-628185 68.5 1.5e-19 1
FN554889_8327 CDS_9626699-9625317 68.3 1.6e-19 1
FN554889_1780 CDS_2125906-2124074 66.1 7.2e-19 1
FN554889_0261 CDS_299160-298066 64.8 1.8e-18 1
FN554889_4210 CDS_4909404-4908232 64.7 1.9e-18 1
FN554889_5537 CDS_6391491-6392729 64.3 2.5e-18 1
FN554889_8141 CDS_9409395-9408136 63.7 3.8e-18 1
FN554889_0947 CDS_1128463-1127261 62.6 8.1e-18 1
FN554889_3864 CDS_4509720-4508392 61.3 1.9e-17 1
FN554889_1727 CDS_2063015-2061738 61.3 1.9e-17 1
FN554889_7483 CDS_8561139-8559883 60.4 3.6e-17 1
FN554889_3245 CDS_3812362-3811019 58.9 9.7e-17 1
FN554889_8523 CDS_9830853-9829768 58.9 1e-16 1
FN554889_8561 CDS_9875487-9874291 56.4 5.2e-16 1
FN554889_0781 CDS_929727-928432 55.3 1.1e-15 1
FN554889_3611 CDS_4225447-4226856 54.0 2.7e-15 1
FN554889_1005 CDS_1197704-1195959 51.0 2.1e-14 1
FN554889_3610 CDS_4224094-4225323 50.6 2.8e-14 1
FN554889_0393 CDS_478082-476349 50.0 4.1e-14 1
FN554889_7302 CDS_8351795-8352619 46.0 6.3e-13 1
FN554889_6728 CDS_7711548-7714373 41.2 1.7e-11 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
FN554889_3814 1/1 189 256 .. 1 70 [] 102.5 1.4e-29
FN554889_0108 1/1 201 269 .. 1 70 [] 98.1 2.8e-28
FN554889_6490 1/1 194 261 .. 1 70 [] 93.4 6.6e-27
FN554889_4050 1/1 224 291 .. 1 70 [] 91.5 2.3e-26
FN554889_3004 1/1 186 254 .. 1 70 [] 90.6 4.4e-26
FN554889_4048 1/1 240 307 .. 1 70 [] 87.7 3.1e-25
FN554889_0573 1/1 159 223 .. 1 70 [] 86.8 5.8e-25
FN554889_5224 1/1 213 280 .. 1 70 [] 85.6 1.3e-24
FN554889_8563 1/1 187 255 .. 1 70 [] 85.3 1.6e-24
FN554889_4205 1/1 182 249 .. 1 70 [] 81.8 1.8e-23
FN554889_0731 1/1 168 236 .. 1 70 [] 80.3 4.9e-23
FN554889_6330 1/1 161 228 .. 1 70 [] 80.0 5.8e-23
FN554889_6376 1/1 201 268 .. 1 70 [] 79.1 1.1e-22
FN554889_1677 1/1 198 265 .. 1 70 [] 79.0 1.2e-22
FN554889_6910 1/1 183 250 .. 1 70 [] 78.5 1.6e-22
FN554889_0845 1/1 201 268 .. 1 70 [] 77.7 2.8e-22
FN554889_7789 1/1 216 283 .. 1 70 [] 77.1 4.3e-22
FN554889_6099 1/1 215 282 .. 1 70 [] 76.3 7.1e-22
FN554889_1356 1/1 117 185 .. 1 70 [] 76.2 7.8e-22
FN554889_2657 1/1 219 284 .. 1 70 [] 75.2 1.5e-21
FN554889_4600 1/1 212 279 .. 1 70 [] 70.7 3.4e-20
FN554889_8335 1/1 121 185 .. 1 70 [] 70.2 4.5e-20
FN554889_2741 1/1 190 255 .. 1 70 [] 70.0 5.2e-20
FN554889_0528 1/1 175 240 .. 1 70 [] 68.5 1.5e-19
FN554889_8327 1/1 236 303 .. 1 70 [] 68.3 1.6e-19
FN554889_1780 1/1 263 331 .. 1 70 [] 66.1 7.2e-19
FN554889_0261 1/1 167 232 .. 1 70 [] 64.8 1.8e-18
FN554889_4210 1/1 181 248 .. 1 70 [] 64.7 1.9e-18
FN554889_5537 1/1 225 289 .. 1 70 [] 64.3 2.5e-18
FN554889_8141 1/1 172 239 .. 1 70 [] 63.7 3.8e-18
FN554889_0947 1/1 198 265 .. 1 70 [] 62.6 8.1e-18
FN554889_3864 1/1 252 319 .. 1 70 [] 61.3 1.9e-17
FN554889_1727 1/1 223 290 .. 1 70 [] 61.3 1.9e-17
FN554889_7483 1/1 196 263 .. 1 70 [] 60.4 3.6e-17
FN554889_3245 1/1 218 289 .. 1 70 [] 58.9 9.7e-17
FN554889_8523 1/1 161 226 .. 1 70 [] 58.9 1e-16
FN554889_8561 1/1 187 254 .. 1 70 [] 56.4 5.2e-16
FN554889_0781 1/1 199 279 .. 1 70 [] 55.3 1.1e-15
FN554889_3611 1/1 278 345 .. 1 70 [] 54.0 2.7e-15
FN554889_1005 1/1 376 441 .. 1 70 [] 51.0 2.1e-14
FN554889_3610 1/1 220 285 .. 3 70 .] 50.6 2.8e-14
FN554889_0393 1/1 378 443 .. 1 70 [] 50.0 4.1e-14
FN554889_7302 1/1 196 233 .. 1 40 [. 46.0 6.3e-13
FN554889_6728 1/1 739 805 .. 2 70 .] 41.2 1.7e-11

Alignments of top-scoring domains:
FN554889_3814: domain 1 of 1, from 189 to 256: score 102.5, E = 1.4e-29
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARELHD+v+++ s++ +q+++a+++l d++p++a++al++i
FN554889_3 189 ERARIARELHDVVAHNVSVMVVQADGAAYVL--DAAPDQAKKALETI 233

relarealaevRrllgdLRpaal<-*
++r+alae+Rrllg+LR++++
FN554889_3 234 SSTGRQALAEMRRLLGVLRTGEH 256

FN554889_0108: domain 1 of 1, from 201 to 269: score 98.1, E = 2.8e-28
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARELHD+v++++s+i++q+++a+++l d+ p+ +re+++ i
FN554889_0 201 ERARIARELHDVVAHHMSVITVQADTAEYRL--DRLPPDVREEFTSI 245

relarealaevRrllgdLR.paal<-*
+++are+l ++Rrllg+LR++ a+
FN554889_0 246 AATARESLGDMRRLLGVLRnEEAH 269

FN554889_6490: domain 1 of 1, from 194 to 261: score 93.4, E = 6.6e-27
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIAR+LHD+v+++++++++q+++a++++ dk p++a+eal+ +
FN554889_6 194 ERLRIARDLHDVVAHHIALVNVQAGVAAHVM--DKRPDQAKEALAHV 238

relarealaevRrllgdLRpaal<-*
re++r al e+R+++g LR +++
FN554889_6 239 REASRSALGELRATVGLLRQSGD 261

FN554889_4050: domain 1 of 1, from 224 to 291: score 91.5, E = 2.3e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+v++++s+i++q+++a +l+ + + ee++e l+ i
FN554889_4 224 ERSRIARELHDVVAHHMSVISIQAQVAPHLT--ENPSEELKENLHGI 268

relarealaevRrllgdLRpaal<-*
r+ a eal+e+Rr+lg+LR
FN554889_4 269 RQNALEALTELRRVLGVLRSEYP 291

FN554889_3004: domain 1 of 1, from 186 to 254: score 90.6, E = 4.4e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+AR+LHD +g+sLs+i+l++ela r+l + +pe+a+++++ i
FN554889_3 186 ERLRLARDLHDLLGHSLSLITLKSELAGRML--PGHPEKAAQQVADI 230

relarealaevRrllgdLR.paal<-*
++ +r+al +vR++++++R+p
FN554889_3 231 EQVSRQALVDVREAVTGYRrPRLG 254

FN554889_4048: domain 1 of 1, from 240 to 307: score 87.7, E = 3.1e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ IARELHD+v++++s++++q+e+a +++ + +p+e+++a+++i
FN554889_4 240 ERTTIARELHDVVAHHMSVVAIQAEAAPYRV--ENPPPELEQAFATI 284

relarealaevRrllgdLRpaal<-*
re a al+e+Rr+lg+ R +
FN554889_4 285 RENAVAALTELRRVLGVVRAEDY 307

FN554889_0573: domain 1 of 1, from 159 to 223: score 86.8, E = 5.8e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIA+ELHD+vgQs++a+ l+l +a+ d+++e++r +l+++
FN554889_0 159 ERRRIAQELHDEVGQSMTAVLLGLKRAA-----DDADEPLRGELHQA 200

relarealaevRrllgdLRpaal<-*
+e+ re+l+evRrl+++LRp++l
FN554889_0 201 QEITRESLDEVRRLVRRLRPGVL 223

FN554889_5224: domain 1 of 1, from 213 to 280: score 85.6, E = 1.3e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD+v+++ s++ +++ ++++++ +kdpe+a + ++ +
FN554889_5 213 ERTRIAREMHDVVAHRVSLMVVHAAALQAVA--RKDPEKAVRNAALV 257

relarealaevRrllgdLRpaal<-*
+++r+al+e+R++lg+LR ++
FN554889_5 258 GDMGRQALTELREMLGVLRSGEG 280

FN554889_8563: domain 1 of 1, from 187 to 255: score 85.3, E = 1.6e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIAR+LHD+v++++++++ q+++a++l+ +++pe+a eal+ i
FN554889_8 187 ERVRIARDLHDVVAHHITLVNAQAGVAHHLM--RANPEQAYEALAHI 231

relarealaevRrllgdLR.paal<-*
++ +r al+e+R+++g LR+ ++
FN554889_8 232 KDNSRAALDELRATVGLLRqYDDA 255

FN554889_4205: domain 1 of 1, from 182 to 249: score 81.8, E = 1.8e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARE+HD ++++ s++++q+e+ ++ +++pe+a++a+d+i
FN554889_4 182 ERARIAREMHDILSHAVSLMIVQAEAGPVAV--RTAPERAEAAFDAI 226

relarealaevRrllgdLRpaal<-*
e++r+a+ ++Rr+lg+LR++a
FN554889_4 227 SEAGRDAMVQLRRMLGVLREGAG 249

FN554889_0731: domain 1 of 1, from 168 to 236: score 80.3, E = 4.9e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+vg+s a+ +q+++ r +l d+dp++ re l +
FN554889_0 168 ERLRIARELHDVVGHSVNAMLVQAGAGRLVL--DTDPDRTRELLSSV 212

relarealaevRrllgdLR.paal<-*
++++r+alae+ r+lg LR +++l
FN554889_0 213 ERTGRDALAELDRVLGLLRaDDDL 236

FN554889_6330: domain 1 of 1, from 161 to 228: score 80.0, E = 5.8e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R +R+LHD +g++Ls+i +++e+arrl+ + d + ++++ i
FN554889_6 161 ERLRFSRDLHDLLGHTLSVIVVKSEAARRLA--PHDMNATLAQIEDI 205

relarealaevRrllgdLRpaal<-*
++ +r+al+e+R++++++R++ l
FN554889_6 206 ETVGRQALTEIREAVTGYREGSL 228

FN554889_6376: domain 1 of 1, from 201 to 268: score 79.1, E = 1.1e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIAR+LHD+v+++L++++ q+++a++l+ ++dpe+a + l+ +
FN554889_6 201 ERMRIARDLHDVVAHHLALANAQAGTAAHLT--RTDPEQAHRILTDL 245

relarealaevRrllgdLRpaal<-*
++ + al+e+ ++g+LR +++
FN554889_6 246 TATTSAALRELKGTVGVLRRPDD 268

FN554889_1677: domain 1 of 1, from 198 to 265: score 79.0, E = 1.2e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+A E+HD+++Q+Ls+ ++ l++a+r+ ++dp++ar++++++
FN554889_1 198 ERQRLATEIHDTLAQGLSSQRMLLQAAERVW--ATDPDAARAHIARA 242

relarealaevRrllgdLRpaal<-*
+e+ +++lae+Rr ++dL pa+l
FN554889_1 243 AEITSHSLAEARRFVHDLAPADL 265

FN554889_6910: domain 1 of 1, from 183 to 250: score 78.5, E = 1.6e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+A ELHD v+Q L++++l +++a++l+ d+dp +a+ +l+++
FN554889_6 183 ERSRLAHELHDAVSQKLFSLRLTAQAAAALV--DRDPSRAKGELQQV 227

relarealaevRrllgdLRpaal<-*
++la ea +e+R+++ +LRpa+l
FN554889_6 228 AALAAEAADELRAAVVELRPAGL 250

FN554889_0845: domain 1 of 1, from 201 to 268: score 77.7, E = 2.8e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIAR+LHD+++Q L++ ++ l++a r d+ p+ ar++++++
FN554889_0 201 ERARIARDLHDTLAQELAGSRMLLQAADRDW--DRRPDLARTQVRTV 245

relarealaevRrllgdLRpaal<-*
+++ lae+R ++gdL p+al
FN554889_0 246 VDALGANLAETRTIIGDLTPPAL 268

FN554889_7789: domain 1 of 1, from 216 to 283: score 77.1, E = 4.3e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARELHD+v ++ s++ +q+++ar+++ d++p++areal ++
FN554889_7 216 ERARIARELHDVVTHNVSVMVIQAGAARTVM--DAHPDRAREALLAV 260

relarealaevRrllgdLRpaal<-*
++ +r a++e+R++ g L p +
FN554889_7 261 EAGGRAAMTELRHVMGLLTPRTP 283

FN554889_6099: domain 1 of 1, from 215 to 282: score 76.3, E = 7.1e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R AR+LHD +g sLsa++l++ela rl+ +++p++a e+l+ i
FN554889_6 215 ERLRFARDLHDLLGFSLSAVTLKSELACRLV--PAAPDRALEELRSI 259

relarealaevRrllgdLRpaal<-*
e++r+al++vR +++++R++ l
FN554889_6 260 LEISRQALSDVRTVARGYRDMSL 282

FN554889_1356: domain 1 of 1, from 117 to 185: score 76.2, E = 7.8e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+v++ L++i+ q++ ++ + dp + +e l++i
FN554889_1 117 ERMRIARELHDVVAHELTLINAQAGIGVHVG--RNDPVQMAELLEAI 161

relarealaevRrllgdLR.paal<-*
r+ ++ al e+R ++g L +p++
FN554889_1 162 RDGSKGALGELRSIVGLLSqPGDA 185

FN554889_2657: domain 1 of 1, from 219 to 284: score 75.2, E = 1.5e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+A E+HD+++Q+L++i+ ql++++ + dpe ar++l+++
FN554889_2 219 ERRRLAAEIHDTIAQGLTGIIAQLQVVAN----APDPETARAHLARA 261

relarealaevRrllgdLRpaal<-*
+lar++l e+Rr +++L p al
FN554889_2 262 GDLARHSLGEARRSVHNLAPVAL 284

FN554889_4600: domain 1 of 1, from 212 to 279: score 70.7, E = 3.4e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R R+LHD++g +L++i+l++ela +l+ +++ +ea e++ e+
FN554889_4 212 ERLRFGRDLHDVIGRNLAVIALKSELAVQLA--RRERPEAVEQMIEV 256

relarealaevRrllgdLRpaal<-*
+++a+++++evR++++++R+a+l
FN554889_4 257 QRIAHDSQREVREVVRGYREADL 279

FN554889_8335: domain 1 of 1, from 121 to 185: score 70.2, E = 4.5e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARELHD+vgQ+L+a+ lql+ + d +p ++ l+++
FN554889_8 121 ERRRLARELHDEVGQTLTAVLLQLGHTA-----DLAPRGIAGDLRQA 162

relarealaevRrllgdLRpaal<-*
+e+ r +l+e+Rr++++LRp++l
FN554889_8 163 QETTRAGLEEIRRIARRLRPGVL 185

FN554889_2741: domain 1 of 1, from 190 to 255: score 70.0, E = 5.2e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+ARELHD v+ +Lsai++++ +a+ +dp+ eal i
FN554889_2 190 ERARMARELHDMVANHLSAIAIHSTAALS----LDDPDTSTEALGVI 232

relarealaevRrllgdLRpaal<-*
re + e+lae+Rrl+g LR+a+
FN554889_2 233 RENSVEGLAEMRRLIGILRDAGA 255

FN554889_0528: domain 1 of 1, from 175 to 240: score 68.5, E = 1.5e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARE+HD+v+++ s+i++q+++++ + + rea+++i
FN554889_0 175 ERTRLAREMHDVVSHQVSLIAVQAGALQVST--GDT--DTREAARTI 217

relarealaevRrllgdLRpaal<-*
r l+ ++l+e+R +++ LR ++
FN554889_0 218 RSLSVTTLDELRTMVTLLRASGG 240

FN554889_8327: domain 1 of 1, from 236 to 303: score 68.3, E = 1.6e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R ARE+HD vg++Ls++ +++a+ l+ ++ e+ ++al+ +
FN554889_8 236 ERSRVAREMHDIVGHNLSVMVSVADGAAVLA--ASRGERSADALRIL 280

relarealaevRrllgdLRpaal<-*
+++r+a+ e+Rr+lg+LR++++
FN554889_8 281 GDTGRQAMGELRRVLGVLREGQD 303

FN554889_1780: domain 1 of 1, from 263 to 331: score 66.1, E = 7.2e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIA E+HD +g++Ls+i l ++++++++ ++ ++e+ e++d +
FN554889_1 263 ERARIAGEMHDLLGHRLSLIVLYAGALEMRT--RTVAPEINEQADLL 307

relarealaevRrllgdLR.paal<-*
r+++r+al+e+R +lg LR ++a+
FN554889_1 308 RTTSRTALDELRGVLGILRlDGAE 331

FN554889_0261: domain 1 of 1, from 167 to 232: score 64.8, E = 1.8e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa +ARE+HD+v+++ s+i++ +++++ ++ +++ a+ea+++i
FN554889_0 167 ERAQLAREMHDVVSHQVSLIAVRAGALQVAT--KDE--DAKEAARTI 209

relarealaevRrllgdLRpaal<-*
r l+ ++l+e+R +++ LR ++
FN554889_0 210 RSLSVTTLDELRTMVTLLRASGG 232

FN554889_4210: domain 1 of 1, from 181 to 248: score 64.7, E = 1.9e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ +ARELHD+v+++ sa+ + +++ r l+ +dp +a eal+ +
FN554889_4 181 EREQLARELHDTVAHHVSAMVIIAQAGRVLA--GTDPSAAVEALEGV 225

relarealaevRrllgdLRpaal<-*
+e + ++l+e+R+++ +LR+ +
FN554889_4 226 EEEGARTLEEMRAMVAALRDREV 248

FN554889_5537: domain 1 of 1, from 225 to 289: score 64.3, E = 2.5e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHD+ Q+L ++++ l+lar ++p+e++++l+++
FN554889_5 225 ERRRIERDLHDGAQQRLVSLSMALGLAR-----LDAPPELAARLAAA 266

relarealaevRrllgdLRpaal<-*
++ a++ l e+R+l+++++p++l
FN554889_5 267 HREADQVLGELRELIHGIHPQVL 289

FN554889_8141: domain 1 of 1, from 172 to 239: score 63.7, E = 3.8e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER +ARELHD v+++ ++i+ q+++a + +++p ++ l +i
FN554889_8 172 ERIQLARELHDFVAHHVTGIIAQAHAAGVIH--ESAPHQVGPILGNI 216

relarealaevRrllgdLRpaal<-*
+e+++++++ +Rrl+++LR++++
FN554889_8 217 AEAGQRTMDSMRRLISVLREDGE 239

FN554889_0947: domain 1 of 1, from 198 to 265: score 62.6, E = 8.1e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+ARELHD+v+ +Lsa+++ + +a ++ + ++ + ldei
FN554889_0 198 ERLRLARELHDVVANRLSAVAMRITAAGHVR--RLPATSESDVLDEI 242

relarealaevRrllgdLRpaal<-*
e ++ al e+R +lg+LR ++
FN554889_0 243 GEEIDSALGELRSMLGTLRSDGG 265

FN554889_3864: domain 1 of 1, from 252 to 319: score 61.3, E = 1.9e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHD+ Q+L+++++ l+lar ++ +++++e re ++++
FN554889_3 252 ERRRIERDLHDGAQQRLTGLIMTLGLARLAV--ADADAETRELVERA 296

relarealaevRrllgdLRpaal<-*
+e a+ +l+e+R+l++++ pa+l
FN554889_3 297 HEQAKVTLTELRDLVHGIFPAVL 319

FN554889_1727: domain 1 of 1, from 223 to 290: score 61.3, E = 1.9e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+ IARE+HD+++++L+++++++++++ + d++ +e+ +a+ i
FN554889_1 223 ARESIAREMHDVLAHRLTLLSVHAGALEFRP--DAPRPEIVRAAGVI 267

relarealaevRrllgdLRpaal<-*
re a+eal+++R+++g+LR +a
FN554889_1 268 RESAHEALQDLREIIGVLRAGAP 290

FN554889_7483: domain 1 of 1, from 196 to 263: score 60.4, E = 3.6e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER +A +LHD v+++ ++i +q+++ar+++ ++p++++ l+ i
FN554889_7 196 ERLAMAADLHDFVAHHVTGILIQTQMARMMV--SSEPDRLDPVLAGI 240

relarealaevRrllgdLRpaal<-*
+++a eal+ +R ++g LR++ +
FN554889_7 241 EHAATEALDSMRLTVGILREGPE 263

FN554889_3245: domain 1 of 1, from 218 to 289: score 58.9, E = 9.7e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrllds.dkdpeearealde
ERaR+ARELHDsv+ +L +++l ++++++ +d ++ dp+++r+++
FN554889_3 218 ERARLARELHDSVAKTLHGLALAADALAASADRpAPDPAQLRRQAGL 264

irelarealaevRrllgdLR.paal<-*
++ +ar+a +e R+ll+dLR++++l
FN554889_3 265 VASAARRAATESRDLLTDLRrHTDL 289

FN554889_8523: domain 1 of 1, from 161 to 226: score 58.9, E = 1e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa +ARE+HD+v+++ s+i++q+++++ ++ + dp + +e +++i
FN554889_8 161 ERAQLAREMHDVVSHQVSLIAVQAGALQ-VA--AIDP-AFKEGARTI 203

relarealaevRrllgdLRpaal<-*
r l+ ++l+e+R++++ LR ++
FN554889_8 204 RSLSVDTLDELRHMVTLLRASGG 226

FN554889_8561: domain 1 of 1, from 187 to 254: score 56.4, E = 5.2e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R +A +LHD v+++ ++i++q+ +a++l +++pe++ l++i
FN554889_8 187 QRLELAHDLHDFVAHHVTGIIVQANAALALQ--HSAPEQITPLLENI 231

relarealaevRrllgdLRpaal<-*
+ ++e+l+ +Rrl+++LR+++
FN554889_8 232 SRSGSETLDSMRRLVRVLREDDR 254

FN554889_0781: domain 1 of 1, from 199 to 279: score 55.3, E = 1.1e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.........
ER +A +LHD v+++ ++i +q+++ar+++ ++ ++++++ +++
FN554889_0 199 ERLAMAADLHDFVAHHVTGILVQSQVARMMA--GTESQrsetgvppd 243

....earealdeirelarealaevRrllgdLRpaal<-*
+ ++++ l+ i+++a eala +Rr++g+LR+ ++
FN554889_0 244 evwgRLDPVLAGIERAATEALASMRRTVGVLRDHGE 279

FN554889_3611: domain 1 of 1, from 278 to 345: score 54.0, E = 2.7e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
+RI R+LHD+ +L a+++ l+la+ l ++dp +a+ +d +
FN554889_3 278 DLRRIERDLHDGAQARLVALAMDLGLAKEKL--AEDPRAAAVMVDSA 322

relarealaevRrllgdLRpaal<-*
++ +++al+e+R+l+++++pa+l
FN554889_3 323 HGEVKTALQELRDLARGIHPAVL 345

FN554889_1005: domain 1 of 1, from 376 to 441: score 51.0, E = 2.1e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RIAR+LHD Q+L+a + l+ a r + + + ea e++ ++
FN554889_1 376 DRDRIARDLHDLAIQRLFATGMTLQSAGRFI--EHP--EASERVLRA 418

relarealaevRrllgdLRpaal<-*
+ ++e+++ +R ++ +LR+ +
FN554889_1 419 VDDLDETIKIIRSTIFGLRTHDG 441

FN554889_3610: domain 1 of 1, from 220 to 285: score 50.6, E = 2.8e-14
*->aRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdeire
+RI R+LHD+ +L ++++l+la+ l +dp++a++ ++e+++
FN554889_3 220 RRIERDLHDGAQARLVNLAMGLGLAKEKL--LEDPDAAATMVEEAHG 264

larealaevRrllgdLRpaal<-*
++ al+e+R+l+++++pa+l
FN554889_3 265 EVKLALQELRDLARGIHPAVL 285

FN554889_0393: domain 1 of 1, from 378 to 443: score 50.0, E = 4.1e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RIAR+LHD Q+L+a + l+ a r + + + ea e++ ++
FN554889_0 378 DRDRIARDLHDLAIQRLFATGMTLQSAGRFI--EHP--EASERVLRA 420

relarealaevRrllgdLRpaal<-*
+ ++e+++ +R ++ +LR +
FN554889_0 421 VDDLDETIKIIRSTIFGLRSREG 443

FN554889_7302: domain 1 of 1, from 196 to 233: score 46.0, E = 6.3e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeea<-*
ER+RIARE+HD++++sL a+++q+++ar+ll +++ + a
FN554889_7 196 ERTRIAREIHDVLAHSLGALSIQIQTARALL--AEPLDTA 233

FN554889_6728: domain 1 of 1, from 739 to 805: score 41.2, E = 1.7e-11
*->RaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdeir
R+RI R+LHD+v Q+L ++ l l + ++l+ +++ e++++ld+++
FN554889_6 739 RRRIERDLHDGVQQRLVSLQLELRMTQTLA--QDPSSELARQLDQLA 783

elarealaevRrllgdLRpaal<-*
+ ++++ +++ +++++++p++l
FN554889_6 784 KGLDDTFQDLLQVARGIHPSIL 805


Histogram of all scores:
score obs exp (one = represents 22 sequences)
----- --- ---
-14 12 0|=
-13 78 1|*===
-12 141 97|====*==
-11 230 801|=========== *
-10 746 1859|================================== *
-9 1271 2112|==========================================================*
-8 1183 1627|====================================================== *
-7 1235 1023|==============================================*==========
-6 1098 579|==========================*=======================
-5 1088 310|==============*===================================
-4 586 162|=======*===================
-3 348 83|===*============
-2 232 42|=*=========
-1 172 21|*=======
0 100 11|*====
1 74 5|*===
2 38 2|*=
3 23 1|*=
4 11 0|=
5 14 0|=
6 3 0|=
7 7 0|=
8 2 0|=
9 2 0|=
10 1 0|=
11 2 0|=
> 12 49 -|===


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 9386.8203
P(chi-square) = 0

Total sequences searched: 8809

Whole sequence top hits:
tophits_s report:
Total hits: 44
Satisfying E cutoff: 44
Total memory: 22K

Domain top hits:
tophits_s report:
Total hits: 44
Satisfying E cutoff: 44
Total memory: 36K


Acknowledgements:

This research is funded by:

Developed by: