Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
264 projects found  

3 accessions found for Erwinia amylovora ATCC 49946  

Data for FN666575  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: FN666575.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
FN666575_2892 CDS_3158068-3156584 79.2 4.1e-23 1
FN666575_2411 CDS_2611461-2612453 55.4 4.3e-16 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
FN666575_2892 1/1 287 354 .. 1 70 [] 79.2 4.1e-23
FN666575_2411 1/1 130 197 .. 1 70 [] 55.4 4.3e-16

Alignments of top-scoring domains:
FN666575_2892: domain 1 of 1, from 287 to 354: score 79.2, E = 4.1e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD++gQ+L++++++++++r ++ kd++ + e++ +
FN666575_2 287 ERKRIAREIHDELGQHLTSLRMGISMLRIQF--SKDNPLLHERVVHL 331

relarealaevRrllgdLRpaal<-*
++l +++++ vR+++++LRp +l
FN666575_2 332 MGLTDKTIQVVRNVATRLRPNVL 354

FN666575_2411: domain 1 of 1, from 130 to 197: score 55.4, E = 4.3e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa IA ELHDs++Q L+ ++ql ++r+l+ d d +a ++ i
FN666575_2 130 ERAAIAGELHDSLAQELTFQRIQLVRLRHLI--DPDYTAALNIVAGI 174

relarealaevRrllgdLRpaal<-*
++ + a +++R+ll ++R +al
FN666575_2 175 EQSLTGAGRQLRELLNNFRLTAL 197


Histogram of all scores:
score obs exp (one = represents 11 sequences)
----- --- ---
-15 1 0|=
-14 20 0|==
-13 105 0|==========
-12 159 38|===*===========
-11 209 315|=================== *
-10 518 730|================================================ *
-9 621 830|========================================================= *
-8 495 639|============================================= *
-7 429 402|====================================*==
-6 331 227|====================*==========
-5 218 122|===========*========
-4 126 63|=====*======
-3 84 32|==*=====
-2 53 16|=*===
-1 30 8|*==
0 21 4|*=
1 8 2|*
2 4 1|*
3 1 0|=
4 1 0|=
> 5 3 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 959.5020
P(chi-square) = 0

Total sequences searched: 3483

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: