Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
264 projects found  

5 accessions found for Erwinia pyrifoliae Ep1/96  

Data for FP236842  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: FP236842.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
FP236842_3084 CDS_3379966-3378482 79.2 4.4e-23 1
FP236842_1124 CDS_1310002-1309022 56.5 2.1e-16 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
FP236842_3084 1/1 287 354 .. 1 70 [] 79.2 4.4e-23
FP236842_1124 1/1 126 193 .. 1 70 [] 56.5 2.1e-16

Alignments of top-scoring domains:
FP236842_3084: domain 1 of 1, from 287 to 354: score 79.2, E = 4.4e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD++gQ+L++++++++++r ++ kd++ + e++ +
FP236842_3 287 ERKRIAREIHDELGQHLTSLRMGISMLRIQF--SKDNPLLHERVVHL 331

relarealaevRrllgdLRpaal<-*
++l +++++ vR+++++LRp +l
FP236842_3 332 MGLTDKTIQVVRNVATRLRPNVL 354

FP236842_1124: domain 1 of 1, from 126 to 193: score 56.5, E = 2.1e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa IA ELHDs++Q L+ ++ql ++rr++ + d+ a + ++ +
FP236842_1 126 ERATIAAELHDSLAQELTFQRIQLVRLRRAI--EPDDTTALDIVAGM 170

relarealaevRrllgdLRpaal<-*
++ + a +++R+ll ++R ++
FP236842_1 171 EQSLTGASRQLRELLNNFRLTVA 193


Histogram of all scores:
score obs exp (one = represents 13 sequences)
----- --- ---
-15 1 0|=
-14 18 0|==
-13 93 0|========
-12 125 40|===*======
-11 219 334|================= *
-10 550 775|=========================================== *
-9 713 880|======================================================= *
-8 509 678|======================================== *
-7 461 426|================================*===
-6 359 241|==================*=========
-5 259 129|=========*==========
-4 146 67|=====*======
-3 76 34|==*===
-2 41 17|=*==
-1 28 9|*==
0 23 4|*=
1 10 2|*
2 4 1|*
3 5 0|=
4 1 0|=
> 5 4 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 753.3641
P(chi-square) = 0

Total sequences searched: 3702

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: