Events News Research CBS CBS Publications Bioinformatics
Staff Contact About Internal CBS CBS Other

MatrixPlot 1.2: Align format for proteins

Introduction Data format User matrix Mutual Nucl Mutual Prot Dist matrix

For the align format each line has to begin with a ">" followed by the sequence. All sequences must have the same length, and may consist of upper and/or lower case letters. (The sequences here are from SRP database). The letters for protein sequences as defined in the alphabet file with ``-'' to indicate gaps.


> MVYVDSWEEFVERSVQLFRGDPNATRYVMKYRHCEGKLVLKVTDDRECLKFKTDQAQDAKKMEKLNNIFFALMTRG
> MTYFTSWDEFAKAAERLHSANPEKCRFVTKYNHTKGQLVLKLTDDVVCLQYSTNQLQDVKKLEKLSSTLLRGIVTQ
> -AQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGSLCIKVTDDLVCLVYRTDQAQDVKKIEKFHSQLMRLMVAK
> MPQFQTWEEFSRAAEKLYLADPMKVRVVLKYRHVDGNLCIKVTDDLVCLVYRTDQAQDVKKIEKFHSQLMRLMVAK
> -PQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVYKTDQAQDVKKIEKFHSQLMRLMVAK




GETTING HELP

Scientific problems:        Technical problems: