Events News Research CBS CBS Publications Bioinformatics
Staff Contact About Internal CBS CBS Other

MatrixPlot 1.2: Fasta format for proteins

Introduction Data format User matrix Mutual Nucl Mutual Prot Dist matrix

For the fasta format each line has to begin with a ">" followed by the sequence name (no spaces allowed). The sequence is displayed on the following lines. (The sequences here are from SRP database)


>ZEA-MAY-
MVYVDSWEEFVERSVQLFRGDPNATRYVMKYRHCEGK
LVLKVTDDRECLKFKTDQAQDAKKMEKLNNIFFALMTRG
>CAE-ELE-
MTYFTSWDEFAKAAERLHSANPEKCRFVTKYNHTKGQLV
LKLTDDVVCLQYSTNQLQDVKKLEKLSSTLLRGIVTQ
>CAN-SPE-
-AQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGSL
CIKVTDDLVCLVYRTDQAQDVKKIEKFHSQLMRLMVAK
>MUS-MUS-
MPQFQTWEEFSRAAEKLYLADPMKVRVVLKYRH
VDGNLCIKVTDDLVCLVYRTDQAQDVKKIEKFHS
QLMRLMVAK
>HOM-SAP-
-PQYQTWEEFSRAAEKLYLADPMKARVVLKYRH
SDGNLCVKVTDDLVCLVYKTDQAQDVKKIEKFHSQLMRLMVAK




GETTING HELP

Scientific problems:        Technical problems: