Events News Research CBS CBS Publications Bioinformatics
Staff Contact About Internal CBS CBS Other

Output format



DESCRIPTION

The following example has a correct prediction at serine at position 1.

EXAMPLE OUTPUT



>RS0A_YEAST - netAcet 1.0 prediction
SLPATFDLTPEDAQLLLAANTHLGARNVQVHQEPYVFNARPDGVHVINVGKTWEKLVLAARIIAAIPNPEDVVAISSRTF
GQRAVLKFAAHTGATPIAGRFTPGSFTNYITRSFKEPRLVIVTDPRSDAQAIKEASYVNIPVIALTDLDSPSEFVDVAIP
CNNRGKHSIGLIWYLLAREVLRLRGALVDRTQPWSIMPDLYFYRDPEEVEQQVAEEATTEEAGEEEAKEEVTEEQAEATE
WAEENADNVEW

#Seq-Position-Residue     Score   Acetylation predicted
#------------------------------------------------------
RS0A_YEAST-1-S            0.513   yes

//





GETTING HELP

Scientific problems:        Technical problems: