|
Output Format
Description
The default output format is short. When short output is chosen
each input sequence will be shown with the predicted cleavage site indicated,
with symbol S.
Example output (for short format)
45 MUC_HUMAN
VTSAPMPEPQAPGRYFAHSILTVSEEEWNTGETYTCVVAHEALPN
...............S......S..............S.......
The long format provides probability of being cleaved for each position.
This might be
usefull to adjust to analyze the reliability levels of certain sites.
Example output (for long format)
>MUC_HUMAN length = 45
# pos aa Pred. P
1 V . 0.010
2 T . 0.001
3 S . 0.017
4 A . 0.047
5 P . 0.043
6 M . 0.001
7 P . 0.449
8 E . 0.000
9 P . 0.004
10 Q . 0.000
11 A . 0.245
12 P . 0.021
13 G . 0.000
14 R . 0.309
15 Y . 0.445
16 F S 0.661
17 A . 0.000
18 H . 0.043
19 S . 0.025
20 I . 0.084
21 L . 0.087
22 T . 0.000
23 V S 0.990
24 S . 0.019
25 E . 0.478
26 E . 0.000
27 E . 0.001
28 W . 0.028
29 N . 0.000
30 T . 0.001
31 G . 0.000
32 E . 0.002
33 T . 0.001
34 Y S 0.523
35 T . 0.011
36 C . 0.002
37 V . 0.002
38 V S 0.948
39 A . 0.109
40 H . 0.065
41 E . 0.078
42 A . 0.471
43 L . 0.156
44 P . 0.001
45 N . 0.009
GETTING HELP
Scientific problems:
Technical problems:
|
