Events News Research CBS CBS Publications Bioinformatics
Staff Contact About Internal CBS CBS Other

CBS >> CBS Prediction Servers >> NetChop 3.0 >> Output format

Output Format

Description



The long format output (default) consists of 5 columns:

  • Residue number.
  • Amino Acid
  • Asigned Prediction ('S' for prediction > threshold, '.' otherwise)
    NOTE: the predicted cleavage site is after the assigned 'S' i.e. the peptide-bond on the C-terminal side of an amino acid with an assigned 'S' is cleaved.
  • Predcition score
  • Sequence name

When short output is chosen each input sequence will be shown with the predicted cleavage site indicated, with symbol S.

For each sequence the prediction ends with a line stating how many cleavage sites were identified.

EXAMPLE OUTPUT


Example output (long format)

--------------------------------------
 pos  AA  C      score      Ident
--------------------------------------
...

  74   E  .   0.107631 143B_BOVIN
  75   K  .   0.117492 143B_BOVIN
  76   K  .   0.083109 143B_BOVIN
  77   Q  .   0.557462 143B_BOVIN
  78   Q  S   0.850332 143B_BOVIN
  79   M  .   0.123313 143B_BOVIN
  80   G  .   0.344005 143B_BOVIN
...
--------------------------------------

Number of cleavage sites 74. Number of amino acids 245. Protein name 143B_BOVIN

--------------------------------------

Example output (short format)

245 143B_BOVIN
TMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQ
.S.S...S.SS.S......S.....SSS.....




GETTING HELP

Scientific problems:        Technical problems:       

This file was last modified Wednesday 12th 2009f August 2009 12:12:42 GMT