Events News Research CBS CBS Publications Bioinformatics
Staff Contact About Internal CBS CBS Other

Output format



DESCRIPTION

The output with graphics enabled consist of three parts.

The first part is an output in HOW format which contains on the first line the number of residues and the sequence name. Then follows the amino acid sequence and below is a representation of each amino acid with the corresponding prediction ('C' for cleavage site and '.' for nothing).

The second part is a listing of the examined residues (glutamines), their score, and in case the score exceeds the 0.5 threshold the amino acids around the cleavage site.

The third part is a graphical representation of the table in the second part of the output.

Multiple sequences are separated with '//'.




EXAMPLE OUTPUT


   703 AT6B_HUMAN 
MAELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCPEQDVPFDGSSLDVGMDVSPSEPPWELLP      80
IFPDLQVKSEPSSPCSSSSLSSESSRLSTEPSSEALGVGEVLHVKTESLAPPLCLLGDDPTSSFETVQINVIPTSDDSSD     160
VQTKIEPVSPCSSVNSEASLLSADSSSQAFIGEEVLEVKTESLSPSGCLLWDVPAPSLGAVQISMGPSLDGSSGKALPTR     240
KPPLQPKPVVLTTVPMPSRAVPPSTTVLLQSLVQPPPVSPVVLIQGAIRVQPEGPAPSLPRPERKSIVPAPMPGNSCPPE     320
VDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQAVLADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCI     400
MVFLLFIAFNFGPVSISEPPSAPISPRMNKGEPQPRRHLLGFSEQEPVQGVEPLQGSSQGPKEPQPSPTDQPSFSNLTAF     480
PGGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQRAQERQKSQPRKKSPPVKAVPIQPPGPP     560
ERDSVGQLQLYRHPDRSQPAFLDAIDRREDTFYVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYE     640
EMMQIECEVMDTRVIHIKTSTVPPSLRKQPSPTPGNATGGPLPVSAASQAHQASHQPLYLNHP
................................................................................      80
................................................................................     160
................................................................................     240
................................................................................     320
.....................................C..........................................     400
................................................................................     480
................................................................................     560
................................................................................     640
...............................................................
 
Pos     Score   Cleavage
___________________________
30      0.251   none
45      0.067   none
47      0.063   none
54      0.067   none
86      0.235   none
148     0.069   none
162     0.153   none
188     0.169   none
222     0.063   none
245     0.462   none
270     0.393   none
274     0.075   none
285     0.108   none
291     0.102   none
329     0.065   none
330     0.066   none
341     0.281   none
351     0.333   none
358     0.916   EARLQ^AVLAD
365     0.067   none
366     0.062   none
434     0.066   none
445     0.061   none
449     0.100   none
455     0.196   none
459     0.064   none
465     0.064   none
471     0.125   none
494     0.068   none
521     0.073   none
524     0.080   none
532     0.071   none
535     0.071   none
538     0.063   none
541     0.082   none
555     0.073   none
567     0.083   none
569     0.085   none
578     0.071   none
644     0.076   none
669     0.072   none
689     0.150   none
692     0.097   none
696     0.079   none
___________________________



//





GETTING HELP

Scientific problems:        Technical problems: