Events News Research CBS CBS Publications Bioinformatics
Staff Contact About Internal CBS CBS Other

Output format



DESCRIPTION

For each input sequence the length and the name of the sequence are stated followed by a table with the prediction results. There is a table row for each lysine residue in the sequence; the columns are:

  • sequence name, truncated to 20 characters;

  • residue position in the sequence;

  • score, a number between -1 and 1; when the score is above 0 the residue is a predicted glycation site;

  • the word "glycate";

  • answer: either the word "YES" or a dot ("."), reflecting the score.

After the table, the whole sequence is printed alongside a summary of the predicted glycation sites and their positions.

Finally, if the 'Generate graphics' button has been checked, the server displays a figure in GIF showhing a plot of the score for each lysine residue against the sequence position of that residue.


EXAMPLE OUTPUT

The example below shows the output for the UniProt entry P19111 (PPBI_BOVIN), an intestinal alkaline phosphatase precursor whose activity is known to be inhibited by glycation ( McCarthy et al. 1998). At this point (Feb 2006) the glycation sites have not been determined experimentally and published.

>PPBI_BOVIN	533 amino acids
#
# netglycate-1.0 prediction results
#
# Sequence                      #    Score            Answer
# -----------------------------------------------------------
# PPBI_BOVIN                   43   -0.917   glycate     . 
# PPBI_BOVIN                   44   -0.883   glycate     . 
# PPBI_BOVIN                   53   -0.653   glycate     . 
# PPBI_BOVIN                   75    0.567   glycate    YES
# PPBI_BOVIN                   81   -0.808   glycate     . 
# PPBI_BOVIN                  100    0.817   glycate    YES
# PPBI_BOVIN                  123   -0.587   glycate     . 
# PPBI_BOVIN                  141    0.803   glycate    YES
# PPBI_BOVIN                  156   -0.711   glycate     . 
# PPBI_BOVIN                  157   -0.864   glycate     . 
# PPBI_BOVIN                  160   -0.885   glycate     . 
# PPBI_BOVIN                  224   -0.837   glycate     . 
# PPBI_BOVIN                  247    0.491   glycate    YES
# PPBI_BOVIN                  249   -0.704   glycate     . 
# PPBI_BOVIN                  259   -0.879   glycate     . 
# PPBI_BOVIN                  294   -0.825   glycate     . 
# PPBI_BOVIN                  303    0.972   glycate    YES
# PPBI_BOVIN                  342   -0.845   glycate     . 
# PPBI_BOVIN                  359   -0.950   glycate     . 
# PPBI_BOVIN                  400    0.721   glycate    YES
# PPBI_BOVIN                  405   -0.521   glycate     . 
#
    MQGACVLLLLGLHLQLSLGLVPVEEEDPAFWNRQAAQALDVAKKLQPIQT   #     50
    AAKNVILFLGDGMGVPTVTATRILKGQMNGKLGPETPLAMDQFPYVALSK   #    100
    TYNVDRQVPDSAGTATAYLCGVKGNYRTIGVSAAARYNQCKTTRGNEVTS   #    150
    VMNRAKKAGKSVGVVTTTRVQHASPAGAYAHTVNRNWYSDADLPADAQMN   #    200
    GCQDIAAQLVNNMDIDVILGGGRKYMFPVGTPDPEYPDDASVNGVRKRKQ   #    250
    NLVQAWQAKHQGAQYVWNRTALLQAADDSSVTHLMGLFEPADMKYNVQQD   #    300
    HTKDPTLQEMTEVALRVVSRNPRGFYLFVEGGRIDHGHHDDKAYMALTEA   #    350
    GMFDNAIAKANELTSELDTLILVTADHSHVFSFGGYTLRGTSIFGLAPSK   #    400
    ALDSKSYTSILYGNGPGYALGGGSRPDVNDSTSEDPSYQQQAAVPQASET   #    450
    HGGEDVAVFARGPQAHLVHGVEEETFVAHIMAFAGCVEPYTDCNLPAPTT   #    500
    ATSIPDAAHLAASPPPLALLAGAMLLLLAPTLY                    #    550
%1  ..................................................   #     50
%1  ........................G........................G   #    100
%1  ........................................G.........   #    150
%1  ..................................................   #    200
%1  ..............................................G...   #    250
%1  ..................................................   #    300
%1  ..G...............................................   #    350
%1  .................................................G   #    400
%1  ..................................................   #    450
%1  ..................................................   #    500
%1  .................................







GETTING HELP

Scientific problems:        Technical problems: