NetOGlyc 2.0 Output Format
If the Potential > Threshold then O-glycosylation is predicted at that site.
Predicted sites are assigned S and T
In this example Thr 19 and 22 and Ser 18 are predicted to be O-glycosylated.
The higher the potential the higher is the confidence of the prediction
The figure (using: Generate graphics) shows the potential and threshold versus
sequence position.
Alternative not predicted sites may be found where the potential is high (>0.2) and threshold
low (<0.55).
Name: seq.example Length: 41
ASYDGHKLVAGYDFTPPSTPSTDDPNVCREYSYKLGTYGAP
.................ST..T...................
Name Residue No. Potential Threshold Assignment
seq.example Thr 15 0.4863 0.5584 .
seq.example Thr 19 0.9892 0.5075 T
seq.example Thr 22 0.6054 0.5164 T
seq.example Thr 37 0.0204 0.5271 .
Name Residue No. Potential Threshold Assignment
seq.example Ser 2 0.0006 0.5170 .
seq.example Ser 18 0.9957 0.5139 S
seq.example Ser 21 0.4320 0.5080 .
seq.example Ser 32 0.0004 0.6252 .
GETTING HELP
Scientific problems:
Technical problems:
|
