Output format



DESCRIPTION

For each input sequence the length and the name of the sequence are stated followed by a table with the prediction results. There is a table row for each serine or threonine residue in the sequence; the columns are:

  • sequence name, truncated to 20 characters;

  • residue position in the sequence;

  • residue: serine (S) or threonine (T);

  • score, a number between 0 and 1; when the score is above 0.5 the residue is a predicted phosphorylation site;

  • kinase: the current version of NetPhosBac does not make kinase specific predictions;

  • answer: either the word "YES" or a dot ("."), reflecting the score.

After the table, the whole sequence is printed alongside a summary of the predicted glycation sites and their positions.

Finally, if the 'Generate graphics' button has been checked, the server displays a figure in GIF showing a plot of the score for each serine or threonine residue against the sequence position of that residue. -->


EXAMPLE OUTPUT

The example below shows the output for the UniProt entry P0A6C7 --> Amino-acid acetyltransferase -->
>sp_P0A6C7_ARGA_ECO57	443 amino acids
#
# netphosbac-1.0a prediction results
#
# Sequence		   # x   Context     Score   Kinase    Answer
# -------------------------------------------------------------------
# sp_P0A6C7_ARGA_ECO57     7 T   KERKTELVE   0.319   main        .
# sp_P0A6C7_ARGA_ECO57    16 S   GFRHSVPYI   0.591   main        Y
# sp_P0A6C7_ARGA_ECO57    22 T   PYINTHRGK   0.482   main        .
# sp_P0A6C7_ARGA_ECO57    27 T   HRGKTFVIM   0.474   main        .
# sp_P0A6C7_ARGA_ECO57    43 S   HENFSSIVN   0.461   main        .
# sp_P0A6C7_ARGA_ECO57    44 S   ENFSSIVND   0.498   main        .
# sp_P0A6C7_ARGA_ECO57    54 S   GLLHSLGIR   0.673   main        Y
# sp_P0A6C7_ARGA_ECO57    89 T   NIRVTDAKT   0.199   main        .
# sp_P0A6C7_ARGA_ECO57    93 T   TDAKTLELV   0.420   main        .
# sp_P0A6C7_ARGA_ECO57   103 T   QAAGTLQLD   0.171   main        .
# sp_P0A6C7_ARGA_ECO57   109 T   QLDITARLS   0.452   main        .
# sp_P0A6C7_ARGA_ECO57   113 S   TARLSMSLN   0.271   main        .
# sp_P0A6C7_ARGA_ECO57   115 S   RLSMSLNNT   0.306   main        .
# sp_P0A6C7_ARGA_ECO57   119 T   SLNNTPLQG   0.160   main        .
# sp_P0A6C7_ARGA_ECO57   130 S   INVVSGNFI   0.439   main        .
# sp_P0A6C7_ARGA_ECO57   150 S   DYCHSGRIR   0.839   main        Y
# sp_P0A6C7_ARGA_ECO57   167 S   RQLDSGAIV   0.488   main        .
# sp_P0A6C7_ARGA_ECO57   179 S   PVAVSVTGE   0.305   main        .
# sp_P0A6C7_ARGA_ECO57   181 T   AVSVTGESF   0.285   main        .
# sp_P0A6C7_ARGA_ECO57   184 S   VTGESFNLT   0.499   main        .
# sp_P0A6C7_ARGA_ECO57   188 T   SFNLTSEEI   0.202   main        .
# sp_P0A6C7_ARGA_ECO57   189 S   FNLTSEEIA   0.418   main        .
# sp_P0A6C7_ARGA_ECO57   194 T   EEIATQLAI   0.228   main        .
# sp_P0A6C7_ARGA_ECO57   210 S   IGFCSSQGV   0.476   main        .
# sp_P0A6C7_ARGA_ECO57   211 S   GFCSSQGVT   0.413   main        .
# sp_P0A6C7_ARGA_ECO57   215 T   SQGVTNDDG   0.184   main        .
# sp_P0A6C7_ARGA_ECO57   223 S   GDIVSELFP   0.342   main        .
# sp_P0A6C7_ARGA_ECO57   245 S   GDYNSGTVR   0.533   main        Y
# sp_P0A6C7_ARGA_ECO57   247 T   YNSGTVRFL   0.359   main        .
# sp_P0A6C7_ARGA_ECO57   260 S   KACRSGVRR   0.776   main        Y
# sp_P0A6C7_ARGA_ECO57   269 S   CHLISYQED   0.312   main        .
# sp_P0A6C7_ARGA_ECO57   282 S   QELFSRDGI   0.319   main        .
# sp_P0A6C7_ARGA_ECO57   288 T   DGIGTQIVM   0.264   main        .
# sp_P0A6C7_ARGA_ECO57   294 S   IVMESAEQI   0.516   main        Y
# sp_P0A6C7_ARGA_ECO57   302 T   IRRATINDI   0.318   main        .
# sp_P0A6C7_ARGA_ECO57   326 S   LVRRSREQL   0.456   main        .
# sp_P0A6C7_ARGA_ECO57   338 T   IDKFTIIQR   0.451   main        .
# sp_P0A6C7_ARGA_ECO57   345 T   QRDNTTIAC   0.442   main        .
# sp_P0A6C7_ARGA_ECO57   346 T   RDNTTIACA   0.309   main        .
# sp_P0A6C7_ARGA_ECO57   374 S   PDYRSSSRG   0.287   main        .
# sp_P0A6C7_ARGA_ECO57   375 S   DYRSSSRGE   0.771   main        Y
# sp_P0A6C7_ARGA_ECO57   376 S   YRSSSRGEV   0.701   main        Y
# sp_P0A6C7_ARGA_ECO57   392 S   QAKQSGLSK   0.288   main        .
# sp_P0A6C7_ARGA_ECO57   395 S   QSGLSKLFV   0.581   main        Y
# sp_P0A6C7_ARGA_ECO57   401 T   LFVLTTRSI   0.432   main        .
# sp_P0A6C7_ARGA_ECO57   402 T   FVLTTRSIH   0.362   main        .
# sp_P0A6C7_ARGA_ECO57   404 S   LTTRSIHWF   0.729   main        Y
# sp_P0A6C7_ARGA_ECO57   414 T   ERGFTPVDI   0.359   main        .
# sp_P0A6C7_ARGA_ECO57   424 S   LLPESKKQL   0.294   main        .
# sp_P0A6C7_ARGA_ECO57   435 S   YQRKSKVLM   0.548   main        Y
#
    MVKERKTELVEGFRHSVPYINTHRGKTFVIMLGGEAIEHENFSSIVNDIG   #     50
    LLHSLGIRLVVVYGARPQIDANLAAHHHEPLYHKNIRVTDAKTLELVKQA   #    100
    AGTLQLDITARLSMSLNNTPLQGAHINVVSGNFIIAQPLGVDDGVDYCHS   #    150
    GRIRRIDEDAIHRQLDSGAIVLMGPVAVSVTGESFNLTSEEIATQLAIKL   #    200
    KAEKMIGFCSSQGVTNDDGDIVSELFPNEAQARVEAQEEKGDYNSGTVRF   #    250
    LRGAVKACRSGVRRCHLISYQEDGALLQELFSRDGIGTQIVMESAEQIRR   #    300
    ATINDIGGILELIRPLEQQGILVRRSREQLEMEIDKFTIIQRDNTTIACA   #    350
    ALYPFPEEKIGEMACVAVHPDYRSSSRGEVLLERIAAQAKQSGLSKLFVL   #    400
    TTRSIHWFQERGFTPVDIDLLPESKKQLYNYQRKSKVLMADLG          #    450
%1  ...............S..................................   #     50
%1  ...S..............................................   #    100
%1  .................................................S   #    150
%1  ..................................................   #    200
%1  ............................................S.....   #    250
%1  .........S.................................S......   #    300
%1  ..................................................   #    350
%1  ........................SS..................S.....   #    400
%1  ...S..............................S........
.



GETTING HELP

Scientific problems:        Technical problems: