Events News Research CBS CBS Publications Bioinformatics
Staff Contact About Internal CBS CBS Other

Output format



DESCRIPTION

For each input sequence the length and the name of the sequence are stated followed by a table with the prediction results. There is a table row for each serine or threonine residue in the sequence; the columns are:

  • sequence name, truncated to 20 characters;

  • residue position in the sequence;

  • residue: serine (S) or threonine (T);

  • score, a number between 0 and 1; when the score is above 0.5 the residue is a predicted phosphorylation site;

  • kinase: the current version of NetPhosBac does not make kinase specific predictions;

  • answer: either the word "YES" or a dot ("."), reflecting the score.

After the table, the whole sequence is printed alongside a summary of the predicted glycation sites and their positions.

Finally, if the 'Generate graphics' button has been checked, the server displays a figure in GIF showing a plot of the score for each serine or threonine residue against the sequence position of that residue. -->


EXAMPLE OUTPUT

The example below shows the output for the UniProt entry P0A6C7 --> Amino-acid acetyltransferase -->
>sp_P0A6C7_ARGA_ECO57	443 amino acids
#
# netphosbac-1.0a prediction results
#
# Sequence		   # x   Context     Score   Kinase    Answer
# -------------------------------------------------------------------
# sp_P0A6C7_ARGA_ECO57     7 T   KERKTELVE   0.319   main        .
# sp_P0A6C7_ARGA_ECO57    16 S   GFRHSVPYI   0.591   main        Y
# sp_P0A6C7_ARGA_ECO57    22 T   PYINTHRGK   0.482   main        .
# sp_P0A6C7_ARGA_ECO57    27 T   HRGKTFVIM   0.474   main        .
# sp_P0A6C7_ARGA_ECO57    43 S   HENFSSIVN   0.461   main        .
# sp_P0A6C7_ARGA_ECO57    44 S   ENFSSIVND   0.498   main        .
# sp_P0A6C7_ARGA_ECO57    54 S   GLLHSLGIR   0.673   main        Y
# sp_P0A6C7_ARGA_ECO57    89 T   NIRVTDAKT   0.199   main        .
# sp_P0A6C7_ARGA_ECO57    93 T   TDAKTLELV   0.420   main        .
# sp_P0A6C7_ARGA_ECO57   103 T   QAAGTLQLD   0.171   main        .
# sp_P0A6C7_ARGA_ECO57   109 T   QLDITARLS   0.452   main        .
# sp_P0A6C7_ARGA_ECO57   113 S   TARLSMSLN   0.271   main        .
# sp_P0A6C7_ARGA_ECO57   115 S   RLSMSLNNT   0.306   main        .
# sp_P0A6C7_ARGA_ECO57   119 T   SLNNTPLQG   0.160   main        .
# sp_P0A6C7_ARGA_ECO57   130 S   INVVSGNFI   0.439   main        .
# sp_P0A6C7_ARGA_ECO57   150 S   DYCHSGRIR   0.839   main        Y
# sp_P0A6C7_ARGA_ECO57   167 S   RQLDSGAIV   0.488   main        .
# sp_P0A6C7_ARGA_ECO57   179 S   PVAVSVTGE   0.305   main        .
# sp_P0A6C7_ARGA_ECO57   181 T   AVSVTGESF   0.285   main        .
# sp_P0A6C7_ARGA_ECO57   184 S   VTGESFNLT   0.499   main        .
# sp_P0A6C7_ARGA_ECO57   188 T   SFNLTSEEI   0.202   main        .
# sp_P0A6C7_ARGA_ECO57   189 S   FNLTSEEIA   0.418   main        .
# sp_P0A6C7_ARGA_ECO57   194 T   EEIATQLAI   0.228   main        .
# sp_P0A6C7_ARGA_ECO57   210 S   IGFCSSQGV   0.476   main        .
# sp_P0A6C7_ARGA_ECO57   211 S   GFCSSQGVT   0.413   main        .
# sp_P0A6C7_ARGA_ECO57   215 T   SQGVTNDDG   0.184   main        .
# sp_P0A6C7_ARGA_ECO57   223 S   GDIVSELFP   0.342   main        .
# sp_P0A6C7_ARGA_ECO57   245 S   GDYNSGTVR   0.533   main        Y
# sp_P0A6C7_ARGA_ECO57   247 T   YNSGTVRFL   0.359   main        .
# sp_P0A6C7_ARGA_ECO57   260 S   KACRSGVRR   0.776   main        Y
# sp_P0A6C7_ARGA_ECO57   269 S   CHLISYQED   0.312   main        .
# sp_P0A6C7_ARGA_ECO57   282 S   QELFSRDGI   0.319   main        .
# sp_P0A6C7_ARGA_ECO57   288 T   DGIGTQIVM   0.264   main        .
# sp_P0A6C7_ARGA_ECO57   294 S   IVMESAEQI   0.516   main        Y
# sp_P0A6C7_ARGA_ECO57   302 T   IRRATINDI   0.318   main        .
# sp_P0A6C7_ARGA_ECO57   326 S   LVRRSREQL   0.456   main        .
# sp_P0A6C7_ARGA_ECO57   338 T   IDKFTIIQR   0.451   main        .
# sp_P0A6C7_ARGA_ECO57   345 T   QRDNTTIAC   0.442   main        .
# sp_P0A6C7_ARGA_ECO57   346 T   RDNTTIACA   0.309   main        .
# sp_P0A6C7_ARGA_ECO57   374 S   PDYRSSSRG   0.287   main        .
# sp_P0A6C7_ARGA_ECO57   375 S   DYRSSSRGE   0.771   main        Y
# sp_P0A6C7_ARGA_ECO57   376 S   YRSSSRGEV   0.701   main        Y
# sp_P0A6C7_ARGA_ECO57   392 S   QAKQSGLSK   0.288   main        .
# sp_P0A6C7_ARGA_ECO57   395 S   QSGLSKLFV   0.581   main        Y
# sp_P0A6C7_ARGA_ECO57   401 T   LFVLTTRSI   0.432   main        .
# sp_P0A6C7_ARGA_ECO57   402 T   FVLTTRSIH   0.362   main        .
# sp_P0A6C7_ARGA_ECO57   404 S   LTTRSIHWF   0.729   main        Y
# sp_P0A6C7_ARGA_ECO57   414 T   ERGFTPVDI   0.359   main        .
# sp_P0A6C7_ARGA_ECO57   424 S   LLPESKKQL   0.294   main        .
# sp_P0A6C7_ARGA_ECO57   435 S   YQRKSKVLM   0.548   main        Y
#
    MVKERKTELVEGFRHSVPYINTHRGKTFVIMLGGEAIEHENFSSIVNDIG   #     50
    LLHSLGIRLVVVYGARPQIDANLAAHHHEPLYHKNIRVTDAKTLELVKQA   #    100
    AGTLQLDITARLSMSLNNTPLQGAHINVVSGNFIIAQPLGVDDGVDYCHS   #    150
    GRIRRIDEDAIHRQLDSGAIVLMGPVAVSVTGESFNLTSEEIATQLAIKL   #    200
    KAEKMIGFCSSQGVTNDDGDIVSELFPNEAQARVEAQEEKGDYNSGTVRF   #    250
    LRGAVKACRSGVRRCHLISYQEDGALLQELFSRDGIGTQIVMESAEQIRR   #    300
    ATINDIGGILELIRPLEQQGILVRRSREQLEMEIDKFTIIQRDNTTIACA   #    350
    ALYPFPEEKIGEMACVAVHPDYRSSSRGEVLLERIAAQAKQSGLSKLFVL   #    400
    TTRSIHWFQERGFTPVDIDLLPESKKQLYNYQRKSKVLMADLG          #    450
%1  ...............S..................................   #     50
%1  ...S..............................................   #    100
%1  .................................................S   #    150
%1  ..................................................   #    200
%1  ............................................S.....   #    250
%1  .........S.................................S......   #    300
%1  ..................................................   #    350
%1  ........................SS..................S.....   #    400
%1  ...S..............................S........
.



GETTING HELP

Scientific problems:        Technical problems: