Events News Research CBS CBS Publications Bioinformatics
Staff Contact About Internal CBS CBS Other


>2WNS.A.1 TRANSFERASE
ALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQTAQNAGIS
FDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCLIIEDVVTS
GSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKMLEILEQQKKV
DAETVGRVKRFIQE

A prediction using the sequence 2WNS.A.1 will give the following output:


# For publication of results, please cite:
# A generic method for assignment of reliability scores applied to solvent accessibility predictions.
# Bent Petersen, Thomas Nordahl Petersen, Pernille Andersen, Morten Nielsen and Claus Lundegaard
# BMC Structural Biology 2009, 9:51 doi:10.1186/1472-6807-9-51
#
# Column 1: Class assignment - B for buried or E for Exposed - Threshold: 25% exposure, but not based on RSA
# Column 2: Amino acid
# Column 3: Sequence name
# Column 4: Amino acid number
# Column 5: Relative Surface Accessibility - RSA
# Column 6: Absolute Surface Accessibility
# Column 7: Z-fit score for RSA prediction
# Column 8: Probability for Alpha-Helix
# Column 9: Probability for Beta-strand
# Column 10: Probability for Coil
E A  2WNS.A.1               1    0.777  85.680   1.547   0.003   0.003   0.994
E L  2WNS.A.1               2    0.281  51.451   0.503   0.802   0.014   0.185
E G  2WNS.A.1               3    0.530  41.687   1.558   0.938   0.007   0.055
E P  2WNS.A.1               4    0.549  77.846   2.101   0.938   0.007   0.055
B L  2WNS.A.1               5    0.074  13.531   0.513   0.938   0.007   0.055
B V  2WNS.A.1               6    0.068  10.405   1.064   0.975   0.003   0.022
E T  2WNS.A.1               7    0.538  74.662   2.087   0.975   0.003   0.022
E G  2WNS.A.1               8    0.296  23.335   2.326   0.970   0.001   0.030
B L  2WNS.A.1               9    0.029   5.310   0.164   0.970   0.001   0.030
E Y  2WNS.A.1              10    0.326  69.581   1.270   0.923   0.002   0.076
E D  2WNS.A.1              11    0.764 110.107   1.486   0.782   0.003   0.216
B V  2WNS.A.1              12    0.217  33.307   1.603   0.321   0.003   0.675
E Q  2WNS.A.1              13    0.563 100.516   0.817   0.018   0.019   0.964
B A  2WNS.A.1              14    0.058   6.348   0.220   0.018   0.088   0.893
B F  2WNS.A.1              15    0.088  17.662   0.307   0.022   0.552   0.426
E K  2WNS.A.1              16    0.370  76.150   0.997   0.022   0.552   0.426
E F  2WNS.A.1              17    0.454  91.178   0.204   0.021   0.451   0.528
E G  2WNS.A.1              18    0.387  30.481  -0.578   0.019   0.141   0.840
E D  2WNS.A.1              19    0.574  82.742   0.151   0.019   0.141   0.840
B F  2WNS.A.1              20    0.126  25.288   0.725   0.021   0.756   0.223
E V  2WNS.A.1              21    0.393  60.373   0.761   0.018   0.846   0.136
B L  2WNS.A.1              22    0.155  28.289   0.530   0.018   0.846   0.136
E K  2WNS.A.1              23    0.502 103.323   0.020   0.022   0.552   0.426
B S  2WNS.A.1              24    0.319  37.352  -1.215   0.020   0.205   0.775
E G  2WNS.A.1              25    0.502  39.500  -1.743   0.019   0.141   0.840
E L  2WNS.A.1              26    0.384  70.237  -0.338   0.021   0.279   0.699
E S  2WNS.A.1              27    0.449  52.658  -0.193   0.021   0.451   0.528
B S  2WNS.A.1              28    0.158  18.564  -0.225   0.022   0.359   0.619
E P  2WNS.A.1              29    0.452  64.110  -0.834   0.021   0.279   0.699
B I  2WNS.A.1              30    0.232  42.883   0.867   0.023   0.655   0.322
B Y  2WNS.A.1              31    0.115  24.554   0.056   0.021   0.756   0.223
B I  2WNS.A.1              32    0.163  30.155   1.405   0.021   0.756   0.223
B D  2WNS.A.1              33    0.170  24.439  -1.081   0.074   0.484   0.442
B L  2WNS.A.1              34    0.127  23.180   0.923   0.118   0.150   0.732
E R  2WNS.A.1              35    0.377  86.425   0.324   0.278   0.093   0.628
E G  2WNS.A.1              36    0.367  28.883   0.146   0.354   0.048   0.598
B I  2WNS.A.1              37    0.099  18.389  -0.147   0.354   0.048   0.598
B V  2WNS.A.1              38    0.204  31.293  -1.012   0.257   0.016   0.727
E S  2WNS.A.1              39    0.511  59.831  -0.779   0.058   0.017   0.925
B R  2WNS.A.1              40    0.270  61.807   0.663   0.058   0.017   0.925
B P  2WNS.A.1              41    0.212  30.140  -0.022   0.923   0.002   0.076
E R  2WNS.A.1              42    0.603 138.133   1.212   0.970   0.001   0.030
B L  2WNS.A.1              43    0.095  17.340   0.474   0.970   0.001   0.030
B L  2WNS.A.1              44    0.036   6.518   0.464   0.970   0.001   0.030
E S  2WNS.A.1              45    0.352  41.219   1.396   0.970   0.001   0.030
E Q  2WNS.A.1              46    0.301  53.776   1.768   0.970   0.001   0.030
B V  2WNS.A.1              47    0.020   3.105   1.269   0.970   0.001   0.030
B A  2WNS.A.1              48    0.026   2.898   0.818   0.970   0.001   0.030
E D  2WNS.A.1              49    0.440  63.462   1.892   0.970   0.001   0.030
B I  2WNS.A.1              50    0.165  30.451   1.468   0.970   0.001   0.030
B L  2WNS.A.1              51    0.021   3.790   1.276   0.970   0.001   0.030
B F  2WNS.A.1              52    0.072  14.430   0.645   0.970   0.001   0.030
E Q  2WNS.A.1              53    0.585 104.463   1.979   0.970   0.001   0.030
B T  2WNS.A.1              54    0.179  24.786   1.814   0.970   0.001   0.030
B A  2WNS.A.1              55    0.030   3.284   0.243   0.970   0.001   0.030
E Q  2WNS.A.1              56    0.511  91.318   1.607   0.923   0.002   0.076
E N  2WNS.A.1              57    0.836 122.376   0.971   0.782   0.003   0.216
E A  2WNS.A.1              58    0.422  46.493   0.522   0.321   0.003   0.675
E G  2WNS.A.1              59    0.667  52.501  -1.111   0.016   0.005   0.979
B I  2WNS.A.1              60    0.173  32.060   0.007   0.003   0.003   0.994
E S  2WNS.A.1              61    0.636  74.551   1.229   0.005   0.045   0.951
B F  2WNS.A.1              62    0.086  17.320   1.054   0.004   0.197   0.799
E D  2WNS.A.1              63    0.309  44.556   0.085   0.004   0.514   0.481
B T  2WNS.A.1              64    0.074  10.278   0.703   0.001   0.959   0.040
B V  2WNS.A.1              65    0.018   2.720   0.753   0.001   0.959   0.040
B C  2WNS.A.1              66    0.023   3.159   1.210   0.001   0.959   0.040
B G  2WNS.A.1              67    0.037   2.880  -0.003   0.004   0.616   0.381
B V  2WNS.A.1              68    0.054   8.346   1.111   0.005   0.336   0.660
E P  2WNS.A.1              69    0.282  40.087   0.666   0.018   0.088   0.893
E Y  2WNS.A.1              70    0.300  64.003  -0.940   0.115   0.016   0.868
E T  2WNS.A.1              71    0.350  48.600  -1.088   0.176   0.004   0.820
B A  2WNS.A.1              72    0.082   9.003  -2.119   0.321   0.003   0.675
B L  2WNS.A.1              73    0.111  20.361   0.710   0.802   0.014   0.185
B P  2WNS.A.1              74    0.182  25.868   0.084   0.879   0.010   0.111
B L  2WNS.A.1              75    0.104  19.061   0.708   0.938   0.007   0.055
B A  2WNS.A.1              76    0.018   2.006   0.770   0.975   0.003   0.022
B T  2WNS.A.1              77    0.136  18.905   0.910   0.970   0.001   0.030
B V  2WNS.A.1              78    0.151  23.147  -0.019   0.970   0.001   0.030
B I  2WNS.A.1              79    0.041   7.622   0.643   0.988   0.000   0.012
B C  2WNS.A.1              80    0.019   2.640   0.490   0.970   0.001   0.030
E S  2WNS.A.1              81    0.413  48.357   1.221   0.970   0.001   0.030
E T  2WNS.A.1              82    0.431  59.835   0.411   0.923   0.002   0.076
B N  2WNS.A.1              83    0.175  25.664   0.553   0.600   0.003   0.397
E Q  2WNS.A.1              84    0.850 151.774  -0.347   0.016   0.005   0.979
B I  2WNS.A.1              85    0.089  16.410   0.916   0.005   0.015   0.979
E P  2WNS.A.1              86    0.336  47.664  -0.069   0.004   0.138   0.858
B M  2WNS.A.1              87    0.043   8.504   0.261   0.001   0.900   0.099
B L  2WNS.A.1              88    0.034   6.207   0.142   0.001   0.959   0.040
B I  2WNS.A.1              89    0.059  10.878   0.533   0.001   0.959   0.040
B R  2WNS.A.1              90    0.042   9.641  -0.492   0.001   0.900   0.099
B R  2WNS.A.1              91    0.189  43.327   1.011   0.003   0.718   0.279
E K  2WNS.A.1              92    0.320  65.865   0.874   0.004   0.420   0.576
E E  2WNS.A.1              93    0.658 114.918   1.306   0.019   0.141   0.840
E T  2WNS.A.1              94    0.696  96.535  -0.161   0.018   0.047   0.935
E K  2WNS.A.1              95    0.583 119.944  -0.149   0.018   0.088   0.893
E D  2WNS.A.1              96    0.676  97.484  -0.016   0.020   0.205   0.775
E Y  2WNS.A.1              97    0.362  77.274  -0.164   0.021   0.279   0.699
E G  2WNS.A.1              98    0.371  29.229  -1.731   0.022   0.359   0.619
E T  2WNS.A.1              99    0.459  63.663  -0.194   0.021   0.451   0.528
E K  2WNS.A.1             100    0.449  92.400  -0.525   0.021   0.451   0.528
E R  2WNS.A.1             101    0.379  86.699   0.195   0.023   0.655   0.322
B L  2WNS.A.1             102    0.299  54.802  -0.403   0.018   0.846   0.136
B V  2WNS.A.1             103    0.276  42.452  -0.197   0.018   0.846   0.136
E E  2WNS.A.1             104    0.462  80.676  -0.505   0.021   0.756   0.223
E G  2WNS.A.1             105    0.366  28.788  -1.166   0.022   0.552   0.426
E T  2WNS.A.1             106    0.448  62.110  -0.623   0.022   0.359   0.619
B I  2WNS.A.1             107    0.186  34.392  -0.535   0.020   0.205   0.775
E N  2WNS.A.1             108    0.488  71.458   0.676   0.018   0.088   0.893
E P  2WNS.A.1             109    0.663  94.136   0.880   0.018   0.019   0.964
E G  2WNS.A.1             110    0.579  45.599  -0.767   0.003   0.003   0.994
E E  2WNS.A.1             111    0.357  62.350   1.696   0.005   0.045   0.951
E T  2WNS.A.1             112    0.322  44.620   1.838   0.004   0.616   0.381
B C  2WNS.A.1             113    0.023   3.271   1.424   0.001   0.900   0.099
B L  2WNS.A.1             114    0.024   4.321   1.613   0.006   0.962   0.032
B I  2WNS.A.1             115    0.030   5.642   1.224   0.006   0.962   0.032
B I  2WNS.A.1             116    0.026   4.755   1.277   0.011   0.918   0.071
B E  2WNS.A.1             117    0.075  13.033   0.441   0.169   0.612   0.219
B D  2WNS.A.1             118    0.090  12.926  -0.382   0.352   0.332   0.316
B V  2WNS.A.1             119    0.074  11.328   0.571   0.478   0.309   0.214
B V  2WNS.A.1             120    0.081  12.404   0.647   0.538   0.173   0.289
E T  2WNS.A.1             121    0.308  42.761   0.104   0.455   0.046   0.498
B S  2WNS.A.1             122    0.216  25.315   0.268   0.181   0.016   0.803
B G  2WNS.A.1             123    0.178  14.009  -1.613   0.406   0.004   0.590
E S  2WNS.A.1             124    0.357  41.899   0.250   0.858   0.002   0.139
B S  2WNS.A.1             125    0.127  14.931   0.355   0.970   0.001   0.030
B V  2WNS.A.1             126    0.033   5.103   0.136   0.970   0.001   0.030
E L  2WNS.A.1             127    0.300  54.930   1.469   0.988   0.000   0.012
E E  2WNS.A.1             128    0.280  48.864   1.413   0.970   0.001   0.030
B T  2WNS.A.1             129    0.016   2.247   1.090   0.970   0.001   0.030
B V  2WNS.A.1             130    0.067  10.298   0.451   0.970   0.001   0.030
E E  2WNS.A.1             131    0.531  92.766   2.086   0.988   0.000   0.012
B V  2WNS.A.1             132    0.091  14.033   1.432   0.988   0.000   0.012
B L  2WNS.A.1             133    0.018   3.351   1.132   0.970   0.001   0.030
E Q  2WNS.A.1             134    0.532  94.997   1.970   0.970   0.001   0.030
E K  2WNS.A.1             135    0.738 151.807   1.738   0.858   0.002   0.139
B E  2WNS.A.1             136    0.224  39.115   1.166   0.246   0.004   0.750
E G  2WNS.A.1             137    0.737  58.010   0.770   0.003   0.003   0.994
B L  2WNS.A.1             138    0.074  13.604  -0.358   0.005   0.015   0.979
E K  2WNS.A.1             139    0.548 112.682   1.950   0.004   0.514   0.481
B V  2WNS.A.1             140    0.136  20.872   1.493   0.001   0.959   0.040
B T  2WNS.A.1             141    0.170  23.634   1.173   0.001   0.959   0.040
B D  2WNS.A.1             142    0.118  16.989   0.828   0.001   0.959   0.040
B A  2WNS.A.1             143    0.026   2.821   0.855   0.000   0.983   0.017
B I  2WNS.A.1             144    0.025   4.588   0.960   0.000   0.983   0.017
B V  2WNS.A.1             145    0.020   3.074   1.494   0.000   0.983   0.017
B L  2WNS.A.1             146    0.023   4.266   1.283   0.000   0.983   0.017
B L  2WNS.A.1             147    0.030   5.401   0.830   0.001   0.959   0.040
B D  2WNS.A.1             148    0.125  17.940   0.293   0.002   0.816   0.182
E R  2WNS.A.1             149    0.251  57.548   1.003   0.004   0.197   0.799
E E  2WNS.A.1             150    0.440  76.938  -0.160   0.018   0.047   0.935
E Q  2WNS.A.1             151    0.521  92.979   0.330   0.058   0.017   0.925
E G  2WNS.A.1             152    0.600  47.228  -0.105   0.115   0.016   0.868
B G  2WNS.A.1             153    0.107   8.421  -0.968   0.522   0.016   0.462
E K  2WNS.A.1             154    0.451  92.771   1.183   0.717   0.014   0.269
E D  2WNS.A.1             155    0.631  90.927   1.359   0.802   0.014   0.185
E K  2WNS.A.1             156    0.266  54.716   1.505   0.802   0.014   0.185
B L  2WNS.A.1             157    0.084  15.307   0.078   0.802   0.014   0.185
E Q  2WNS.A.1             158    0.668 119.216   1.422   0.802   0.014   0.185
E A  2WNS.A.1             159    0.746  82.264   0.879   0.600   0.003   0.397
E H  2WNS.A.1             160    0.409  74.379   0.821   0.176   0.004   0.820
E G  2WNS.A.1             161    0.785  61.787   0.218   0.003   0.003   0.994
B I  2WNS.A.1             162    0.076  14.079   0.879   0.005   0.045   0.951
E R  2WNS.A.1             163    0.452 103.508   1.409   0.005   0.262   0.733
B L  2WNS.A.1             164    0.065  11.828   0.672   0.021   0.756   0.223
B H  2WNS.A.1             165    0.243  44.238   1.455   0.011   0.918   0.071
B S  2WNS.A.1             166    0.068   7.958   0.001   0.011   0.918   0.071
B V  2WNS.A.1             167    0.048   7.439  -0.173   0.018   0.846   0.136
B C  2WNS.A.1             168    0.058   8.087   0.981   0.021   0.756   0.223
E T  2WNS.A.1             169    0.346  47.949   1.675   0.003   0.718   0.279
B L  2WNS.A.1             170    0.056  10.217   1.000   0.453   0.248   0.299
E S  2WNS.A.1             171    0.522  61.237   0.956   0.717   0.014   0.269
E K  2WNS.A.1             172    0.405  83.391   1.778   0.717   0.014   0.269
B M  2WNS.A.1             173    0.033   6.563   0.438   0.879   0.010   0.111
B L  2WNS.A.1             174    0.121  22.064   1.180   0.938   0.007   0.055
E E  2WNS.A.1             175    0.580 101.291   1.704   0.970   0.001   0.030
B I  2WNS.A.1             176    0.170  31.505   1.032   0.970   0.001   0.030
B L  2WNS.A.1             177    0.036   6.592  -0.837   0.970   0.001   0.030
E E  2WNS.A.1             178    0.536  93.692   1.427   0.923   0.002   0.076
E Q  2WNS.A.1             179    0.856 152.882   1.365   0.858   0.002   0.139
E Q  2WNS.A.1             180    0.457  81.674   1.388   0.246   0.004   0.750
E K  2WNS.A.1             181    0.602 123.790  -0.107   0.016   0.005   0.979
E K  2WNS.A.1             182    0.545 112.086   1.328   0.018   0.019   0.964
B V  2WNS.A.1             183    0.074  11.374  -0.259   0.018   0.019   0.964
E D  2WNS.A.1             184    0.447  64.384   1.394   0.018   0.019   0.964
E A  2WNS.A.1             185    0.691  76.192   1.387   0.923   0.002   0.076
E E  2WNS.A.1             186    0.729 127.409   1.262   0.858   0.002   0.139
B T  2WNS.A.1             187    0.219  30.389   0.792   0.858   0.002   0.139
B V  2WNS.A.1             188    0.121  18.659   1.241   0.970   0.001   0.030
E G  2WNS.A.1             189    0.669  52.682   1.838   0.970   0.001   0.030
E R  2WNS.A.1             190    0.345  79.074   2.359   0.970   0.001   0.030
B V  2WNS.A.1             191    0.029   4.457   0.484   0.970   0.001   0.030
E K  2WNS.A.1             192    0.443  91.146   1.977   0.970   0.001   0.030
E R  2WNS.A.1             193    0.566 129.568   2.122   0.923   0.002   0.076
B F  2WNS.A.1             194    0.132  26.472   0.674   0.923   0.002   0.076
E I  2WNS.A.1             195    0.339  62.807   0.927   0.782   0.003   0.216
E Q  2WNS.A.1             196    0.776 138.540   1.328   0.502   0.002   0.495
E E  2WNS.A.1             197    0.931 162.576   1.532   0.016   0.005   0.979



GETTING HELP

Scientific problems:        Technical problems: