Events News Research CBS CBS Publications Bioinformatics
Staff Contact About Internal CBS CBS Other


>2WNS.A.1 TRANSFERASE
ALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQTAQNAGIS
FDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCLIIEDVVTS
GSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKMLEILEQQKKV
DAETVGRVKRFIQE

A prediction of all Beta-turn types using the sequence 2WNS.A.1 will give the following output:


# Column 1:	Amino acid
# Column 2:	Sequence name
# Column 3:	Amino acid number
# Column 4:	Prediction for Beta-turn
# Column 5:	Class assignment - "T" for Beta-turn
# Column 6:	Prediction for Beta-turn type A
# Column 7:	Class assignment - "A" for Beta-turn type I
# Column 8:	Prediction for Beta-turn type B
# Column 9:	Class assignment - "B" for Beta-turn type I'
# Column 10:	Prediction for Beta-turn type C
# Column 11:	Class assignment - "C" for Beta-turn type II
# Column 12:	Prediction for Beta-turn type D
# Column 13:	Class assignment - "D" for Beta-turn type II'
# Column 14:	Prediction for Beta-turn type E
# Column 15:	Class assignment - "E" for Beta-turn type IV
# Column 16:	Prediction for Beta-turn type F
# Column 17:	Class assignment - "F" for Beta-turn type VIII
# Column 18:	Prediction for Beta-turn type G
# Column 19:	Class assignment - "G" for Beta-turn type VIb
# Column 20:	Prediction for Beta-turn type H
# Column 21:	Class assignment - "H" for Beta-turn type VIa1
# Column 22:	Prediction for Beta-turn type I
# Column 23:	Class assignment - "I" for Beta-turn type VIa2
#
A  2WNS.A.1               1    0.171 .	0.158 .	0.123 .	0.099 .	0.108 .	0.263 .	0.155 .	0.101 .	0.125 .	0.243 .
L  2WNS.A.1               2    0.186 .	0.273 .	0.091 .	0.095 .	0.084 .	0.249 .	0.197 .	0.093 .	0.117 .	0.215 .
G  2WNS.A.1               3    0.251 .	0.329 .	0.078 .	0.095 .	0.066 .	0.262 .	0.193 .	0.077 .	0.104 .	0.192 .
P  2WNS.A.1               4    0.249 .	0.331 .	0.071 .	0.084 .	0.059 .	0.297 .	0.193 .	0.072 .	0.116 .	0.182 .
L  2WNS.A.1               5    0.231 .	0.283 .	0.079 .	0.090 .	0.065 .	0.266 .	0.182 .	0.071 .	0.128 .	0.181 .
V  2WNS.A.1               6    0.204 .	0.245 .	0.086 .	0.093 .	0.078 .	0.238 .	0.156 .	0.072 .	0.120 .	0.181 .
T  2WNS.A.1               7    0.170 .	0.192 .	0.084 .	0.086 .	0.078 .	0.234 .	0.114 .	0.070 .	0.129 .	0.190 .
G  2WNS.A.1               8    0.173 .	0.222 .	0.080 .	0.091 .	0.075 .	0.242 .	0.103 .	0.069 .	0.125 .	0.185 .
L  2WNS.A.1               9    0.211 .	0.288 .	0.086 .	0.141 .	0.086 .	0.260 .	0.114 .	0.079 .	0.129 .	0.190 .
Y  2WNS.A.1              10    0.236 .	0.339 .	0.098 .	0.150 .	0.081 .	0.260 .	0.149 .	0.087 .	0.148 .	0.202 .
D  2WNS.A.1              11    0.260 .	0.360 .	0.126 .	0.226 .	0.111 .	0.272 .	0.166 .	0.141 .	0.211 .	0.214 .
V  2WNS.A.1              12    0.283 .	0.355 .	0.144 .	0.221 .	0.217 .	0.299 .	0.289 .	0.173 .	0.216 .	0.222 .
Q  2WNS.A.1              13    0.499 .	0.310 .	0.144 .	0.232 .	0.179 .	0.403 .	0.748 F	0.166 .	0.208 .	0.232 .
A  2WNS.A.1              14    0.502 T	0.235 .	0.134 .	0.237 .	0.170 .	0.407 .	0.771 F	0.190 .	0.183 .	0.238 .
F  2WNS.A.1              15    0.498 .	0.240 .	0.131 .	0.210 .	0.180 .	0.401 .	0.750 F	0.154 .	0.156 .	0.263 .
K  2WNS.A.1              16    0.545 T	0.186 .	0.215 .	0.562 C	0.151 .	0.490 .	0.748 F	0.176 .	0.185 .	0.265 .
F  2WNS.A.1              17    0.529 T	0.207 .	0.338 .	0.613 C	0.663 D	0.508 E	0.430 .	0.275 .	0.343 .	0.334 .
G  2WNS.A.1              18    0.544 T	0.236 .	0.464 .	0.618 C	0.644 D	0.504 E	0.535 F	0.346 .	0.327 .	0.328 .
D  2WNS.A.1              19    0.538 T	0.210 .	0.422 .	0.610 C	0.637 D	0.511 E	0.500 .	0.271 .	0.306 .	0.289 .
F  2WNS.A.1              20    0.537 T	0.165 .	0.321 .	0.395 .	0.711 D	0.431 .	0.506 F	0.282 .	0.250 .	0.272 .
V  2WNS.A.1              21    0.277 .	0.161 .	0.190 .	0.219 .	0.202 .	0.332 .	0.518 F	0.160 .	0.144 .	0.237 .
L  2WNS.A.1              22    0.462 .	0.450 .	0.140 .	0.211 .	0.101 .	0.400 .	0.400 .	0.141 .	0.146 .	0.257 .
K  2WNS.A.1              23    0.513 T	0.474 .	0.349 .	0.377 .	0.218 .	0.443 .	0.409 .	0.156 .	0.191 .	0.289 .
S  2WNS.A.1              24    0.573 T	0.508 A	0.503 B	0.378 .	0.632 D	0.504 E	0.412 .	0.175 .	0.200 .	0.306 .
G  2WNS.A.1              25    0.624 T	0.549 A	0.489 .	0.415 .	0.688 D	0.551 E	0.476 .	0.167 .	0.191 .	0.363 .
L  2WNS.A.1              26    0.561 T	0.397 .	0.519 B	0.391 .	0.691 D	0.540 E	0.532 F	0.180 .	0.190 .	0.320 .
S  2WNS.A.1              27    0.510 T	0.369 .	0.353 .	0.266 .	0.724 D	0.534 E	0.518 F	0.274 .	0.362 .	0.368 .
S  2WNS.A.1              28    0.585 T	0.456 .	0.189 .	0.267 .	0.496 .	0.514 E	0.640 F	0.271 .	0.316 .	0.352 .
P  2WNS.A.1              29    0.515 T	0.385 .	0.160 .	0.257 .	0.262 .	0.475 .	0.618 F	0.276 .	0.308 .	0.292 .
I  2WNS.A.1              30    0.506 T	0.391 .	0.166 .	0.240 .	0.255 .	0.456 .	0.588 F	0.257 .	0.301 .	0.319 .
Y  2WNS.A.1              31    0.560 T	0.418 .	0.222 .	0.276 .	0.225 .	0.534 E	0.613 F	0.153 .	0.148 .	0.277 .
I  2WNS.A.1              32    0.396 .	0.295 .	0.343 .	0.231 .	0.218 .	0.494 .	0.445 .	0.143 .	0.168 .	0.295 .
D  2WNS.A.1              33    0.463 .	0.383 .	0.324 .	0.209 .	0.291 .	0.568 E	0.410 .	0.163 .	0.247 .	0.382 .
L  2WNS.A.1              34    0.532 T	0.456 .	0.342 .	0.318 .	0.266 .	0.596 E	0.384 .	0.255 .	0.328 .	0.495 .
R  2WNS.A.1              35    0.481 .	0.452 .	0.238 .	0.321 .	0.271 .	0.557 E	0.440 .	0.243 .	0.342 .	0.532 I
G  2WNS.A.1              36    0.508 T	0.511 A	0.152 .	0.379 .	0.224 .	0.576 E	0.460 .	0.304 .	0.329 .	0.497 .
I  2WNS.A.1              37    0.553 T	0.587 A	0.203 .	0.516 C	0.310 .	0.553 E	0.458 .	0.242 .	0.345 .	0.416 .
V  2WNS.A.1              38    0.557 T	0.559 A	0.219 .	0.431 .	0.344 .	0.577 E	0.716 F	0.208 .	0.261 .	0.299 .
S  2WNS.A.1              39    0.553 T	0.565 A	0.272 .	0.394 .	0.352 .	0.548 E	0.704 F	0.431 .	0.431 .	0.343 .
R  2WNS.A.1              40    0.537 T	0.565 A	0.261 .	0.304 .	0.386 .	0.529 E	0.681 F	0.279 .	0.443 .	0.327 .
P  2WNS.A.1              41    0.436 .	0.327 .	0.222 .	0.221 .	0.270 .	0.507 E	0.696 F	0.317 .	0.341 .	0.298 .
R  2WNS.A.1              42    0.268 .	0.282 .	0.185 .	0.197 .	0.171 .	0.303 .	0.158 .	0.208 .	0.344 .	0.287 .
L  2WNS.A.1              43    0.267 .	0.306 .	0.131 .	0.181 .	0.154 .	0.293 .	0.129 .	0.066 .	0.176 .	0.209 .
L  2WNS.A.1              44    0.229 .	0.252 .	0.127 .	0.164 .	0.093 .	0.259 .	0.119 .	0.076 .	0.121 .	0.196 .
S  2WNS.A.1              45    0.189 .	0.246 .	0.103 .	0.099 .	0.099 .	0.239 .	0.102 .	0.069 .	0.127 .	0.202 .
Q  2WNS.A.1              46    0.192 .	0.248 .	0.091 .	0.091 .	0.097 .	0.256 .	0.093 .	0.072 .	0.121 .	0.193 .
V  2WNS.A.1              47    0.204 .	0.254 .	0.095 .	0.090 .	0.138 .	0.250 .	0.099 .	0.078 .	0.115 .	0.190 .
A  2WNS.A.1              48    0.192 .	0.249 .	0.097 .	0.104 .	0.139 .	0.245 .	0.109 .	0.081 .	0.112 .	0.185 .
D  2WNS.A.1              49    0.195 .	0.244 .	0.092 .	0.098 .	0.142 .	0.261 .	0.104 .	0.077 .	0.115 .	0.183 .
I  2WNS.A.1              50    0.190 .	0.248 .	0.092 .	0.089 .	0.143 .	0.248 .	0.102 .	0.079 .	0.115 .	0.185 .
L  2WNS.A.1              51    0.204 .	0.245 .	0.098 .	0.099 .	0.121 .	0.267 .	0.116 .	0.082 .	0.130 .	0.184 .
F  2WNS.A.1              52    0.220 .	0.287 .	0.094 .	0.096 .	0.093 .	0.255 .	0.122 .	0.091 .	0.124 .	0.184 .
Q  2WNS.A.1              53    0.198 .	0.241 .	0.086 .	0.091 .	0.075 .	0.257 .	0.138 .	0.085 .	0.125 .	0.185 .
T  2WNS.A.1              54    0.201 .	0.270 .	0.085 .	0.091 .	0.073 .	0.258 .	0.124 .	0.096 .	0.135 .	0.186 .
A  2WNS.A.1              55    0.278 .	0.356 .	0.112 .	0.275 .	0.103 .	0.295 .	0.146 .	0.112 .	0.127 .	0.190 .
Q  2WNS.A.1              56    0.321 .	0.364 .	0.132 .	0.265 .	0.092 .	0.339 .	0.176 .	0.133 .	0.154 .	0.196 .
N  2WNS.A.1              57    0.362 .	0.432 .	0.221 .	0.308 .	0.146 .	0.377 .	0.231 .	0.172 .	0.272 .	0.231 .
A  2WNS.A.1              58    0.408 .	0.445 .	0.367 .	0.349 .	0.276 .	0.399 .	0.360 .	0.315 .	0.312 .	0.298 .
G  2WNS.A.1              59    0.414 .	0.525 A	0.332 .	0.230 .	0.289 .	0.385 .	0.410 .	0.375 .	0.363 .	0.348 .
I  2WNS.A.1              60    0.415 .	0.487 .	0.348 .	0.268 .	0.311 .	0.399 .	0.551 F	0.490 .	0.390 .	0.380 .
S  2WNS.A.1              61    0.378 .	0.456 .	0.263 .	0.248 .	0.288 .	0.359 .	0.551 F	0.475 .	0.352 .	0.318 .
F  2WNS.A.1              62    0.501 T	0.429 .	0.152 .	0.213 .	0.214 .	0.420 .	0.735 F	0.381 .	0.276 .	0.257 .
D  2WNS.A.1              63    0.449 .	0.212 .	0.120 .	0.189 .	0.117 .	0.407 .	0.740 F	0.249 .	0.201 .	0.230 .
T  2WNS.A.1              64    0.399 .	0.150 .	0.114 .	0.142 .	0.106 .	0.379 .	0.688 F	0.144 .	0.149 .	0.217 .
V  2WNS.A.1              65    0.423 .	0.082 .	0.122 .	0.109 .	0.092 .	0.405 .	0.684 F	0.118 .	0.130 .	0.230 .
C  2WNS.A.1              66    0.153 .	0.064 .	0.114 .	0.092 .	0.104 .	0.250 .	0.202 .	0.234 .	0.182 .	0.275 .
G  2WNS.A.1              67    0.200 .	0.282 .	0.120 .	0.116 .	0.154 .	0.326 .	0.169 .	0.501 .	0.338 .	0.369 .
V  2WNS.A.1              68    0.345 .	0.457 .	0.128 .	0.218 .	0.209 .	0.388 .	0.280 .	0.489 .	0.357 .	0.392 .
P  2WNS.A.1              69    0.538 T	0.552 A	0.140 .	0.449 .	0.242 .	0.457 .	0.318 .	0.499 .	0.416 .	0.404 .
Y  2WNS.A.1              70    0.567 T	0.598 A	0.216 .	0.511 C	0.489 .	0.493 .	0.330 .	0.380 .	0.400 .	0.376 .
T  2WNS.A.1              71    0.579 T	0.560 A	0.191 .	0.501 C	0.536 D	0.491 .	0.313 .	0.132 .	0.253 .	0.306 .
A  2WNS.A.1              72    0.532 T	0.493 .	0.179 .	0.415 .	0.511 D	0.487 .	0.215 .	0.202 .	0.313 .	0.335 .
L  2WNS.A.1              73    0.386 .	0.366 .	0.152 .	0.210 .	0.520 D	0.404 .	0.205 .	0.186 .	0.363 .	0.318 .
P  2WNS.A.1              74    0.290 .	0.232 .	0.090 .	0.117 .	0.288 .	0.338 .	0.196 .	0.160 .	0.276 .	0.304 .
L  2WNS.A.1              75    0.245 .	0.235 .	0.075 .	0.121 .	0.115 .	0.282 .	0.147 .	0.188 .	0.280 .	0.300 .
A  2WNS.A.1              76    0.236 .	0.220 .	0.082 .	0.133 .	0.096 .	0.258 .	0.134 .	0.109 .	0.212 .	0.235 .
T  2WNS.A.1              77    0.206 .	0.199 .	0.083 .	0.126 .	0.089 .	0.236 .	0.112 .	0.094 .	0.128 .	0.206 .
V  2WNS.A.1              78    0.157 .	0.189 .	0.081 .	0.091 .	0.078 .	0.216 .	0.092 .	0.088 .	0.123 .	0.200 .
I  2WNS.A.1              79    0.163 .	0.188 .	0.086 .	0.083 .	0.076 .	0.224 .	0.082 .	0.078 .	0.117 .	0.190 .
C  2WNS.A.1              80    0.188 .	0.207 .	0.086 .	0.110 .	0.077 .	0.250 .	0.098 .	0.093 .	0.109 .	0.191 .
S  2WNS.A.1              81    0.243 .	0.320 .	0.093 .	0.122 .	0.081 .	0.260 .	0.088 .	0.095 .	0.117 .	0.199 .
T  2WNS.A.1              82    0.260 .	0.342 .	0.156 .	0.182 .	0.167 .	0.268 .	0.085 .	0.104 .	0.166 .	0.220 .
N  2WNS.A.1              83    0.252 .	0.361 .	0.193 .	0.199 .	0.286 .	0.262 .	0.132 .	0.136 .	0.173 .	0.227 .
Q  2WNS.A.1              84    0.219 .	0.374 .	0.198 .	0.197 .	0.298 .	0.194 .	0.112 .	0.323 .	0.385 .	0.275 .
I  2WNS.A.1              85    0.202 .	0.218 .	0.225 .	0.247 .	0.307 .	0.278 .	0.308 .	0.388 .	0.328 .	0.256 .
P  2WNS.A.1              86    0.180 .	0.139 .	0.146 .	0.196 .	0.211 .	0.281 .	0.319 .	0.372 .	0.252 .	0.233 .
M  2WNS.A.1              87    0.207 .	0.134 .	0.123 .	0.177 .	0.155 .	0.282 .	0.347 .	0.515 G	0.271 .	0.228 .
L  2WNS.A.1              88    0.224 .	0.122 .	0.108 .	0.152 .	0.094 .	0.303 .	0.389 .	0.193 .	0.118 .	0.202 .
I  2WNS.A.1              89    0.194 .	0.103 .	0.100 .	0.098 .	0.090 .	0.273 .	0.350 .	0.185 .	0.119 .	0.208 .
R  2WNS.A.1              90    0.233 .	0.096 .	0.110 .	0.124 .	0.089 .	0.308 .	0.320 .	0.319 .	0.134 .	0.266 .
R  2WNS.A.1              91    0.316 .	0.219 .	0.149 .	0.138 .	0.105 .	0.422 .	0.445 .	0.399 .	0.223 .	0.347 .
K  2WNS.A.1              92    0.520 T	0.388 .	0.313 .	0.384 .	0.174 .	0.553 E	0.479 .	0.442 .	0.358 .	0.416 .
E  2WNS.A.1              93    0.567 T	0.447 .	0.455 .	0.509 C	0.410 .	0.577 E	0.484 .	0.487 .	0.456 .	0.488 .
T  2WNS.A.1              94    0.634 T	0.507 A	0.494 .	0.567 C	0.486 .	0.605 E	0.556 F	0.395 .	0.462 .	0.450 .
K  2WNS.A.1              95    0.655 T	0.536 A	0.522 B	0.604 C	0.519 D	0.596 E	0.544 F	0.390 .	0.403 .	0.382 .
D  2WNS.A.1              96    0.599 T	0.518 A	0.535 B	0.624 C	0.485 .	0.535 E	0.524 F	0.300 .	0.308 .	0.314 .
Y  2WNS.A.1              97    0.556 T	0.512 A	0.389 .	0.575 C	0.537 D	0.526 E	0.522 F	0.246 .	0.215 .	0.267 .
G  2WNS.A.1              98    0.572 T	0.504 A	0.394 .	0.596 C	0.501 D	0.552 E	0.449 .	0.223 .	0.190 .	0.254 .
T  2WNS.A.1              99    0.547 T	0.468 .	0.435 .	0.598 C	0.514 D	0.535 E	0.444 .	0.144 .	0.171 .	0.229 .
K  2WNS.A.1             100    0.493 .	0.406 .	0.310 .	0.426 .	0.543 D	0.544 E	0.461 .	0.142 .	0.142 .	0.216 .
R  2WNS.A.1             101    0.454 .	0.317 .	0.258 .	0.385 .	0.322 .	0.532 E	0.463 .	0.151 .	0.133 .	0.210 .
L  2WNS.A.1             102    0.390 .	0.247 .	0.236 .	0.234 .	0.216 .	0.464 .	0.470 .	0.133 .	0.129 .	0.214 .
V  2WNS.A.1             103    0.421 .	0.196 .	0.318 .	0.532 C	0.241 .	0.500 E	0.445 .	0.157 .	0.127 .	0.230 .
E  2WNS.A.1             104    0.425 .	0.216 .	0.292 .	0.504 C	0.473 .	0.524 E	0.409 .	0.235 .	0.154 .	0.261 .
G  2WNS.A.1             105    0.437 .	0.284 .	0.304 .	0.495 .	0.399 .	0.518 E	0.517 F	0.342 .	0.207 .	0.392 .
T  2WNS.A.1             106    0.450 .	0.359 .	0.287 .	0.491 .	0.368 .	0.545 E	0.571 F	0.439 .	0.260 .	0.443 .
I  2WNS.A.1             107    0.377 .	0.396 .	0.199 .	0.285 .	0.395 .	0.546 E	0.582 F	0.507 G	0.464 .	0.586 I
N  2WNS.A.1             108    0.815 T	0.518 A	0.261 .	0.827 C	0.293 .	0.568 E	0.579 F	0.439 .	0.547 H	0.549 I
P  2WNS.A.1             109    0.810 T	0.485 .	0.260 .	0.850 C	0.422 .	0.555 E	0.477 .	0.381 .	0.490 .	0.441 .
G  2WNS.A.1             110    0.836 T	0.486 .	0.258 .	0.851 C	0.472 .	0.508 E	0.420 .	0.291 .	0.477 .	0.376 .
E  2WNS.A.1             111    0.835 T	0.466 .	0.266 .	0.846 C	0.455 .	0.459 .	0.436 .	0.194 .	0.277 .	0.250 .
T  2WNS.A.1             112    0.274 .	0.244 .	0.162 .	0.375 .	0.374 .	0.360 .	0.422 .	0.169 .	0.153 .	0.224 .
C  2WNS.A.1             113    0.263 .	0.149 .	0.107 .	0.156 .	0.185 .	0.326 .	0.469 .	0.156 .	0.134 .	0.209 .
L  2WNS.A.1             114    0.160 .	0.087 .	0.093 .	0.092 .	0.086 .	0.202 .	0.396 .	0.139 .	0.123 .	0.204 .
I  2WNS.A.1             115    0.161 .	0.068 .	0.095 .	0.091 .	0.091 .	0.223 .	0.315 .	0.136 .	0.129 .	0.218 .
I  2WNS.A.1             116    0.261 .	0.096 .	0.112 .	0.114 .	0.109 .	0.371 .	0.372 .	0.158 .	0.148 .	0.243 .
E  2WNS.A.1             117    0.325 .	0.161 .	0.111 .	0.135 .	0.128 .	0.447 .	0.368 .	0.151 .	0.175 .	0.266 .
D  2WNS.A.1             118    0.378 .	0.290 .	0.105 .	0.162 .	0.140 .	0.493 .	0.442 .	0.161 .	0.182 .	0.291 .
V  2WNS.A.1             119    0.440 .	0.390 .	0.105 .	0.176 .	0.124 .	0.515 E	0.459 .	0.154 .	0.190 .	0.289 .
V  2WNS.A.1             120    0.550 T	0.451 .	0.103 .	0.197 .	0.124 .	0.566 E	0.453 .	0.146 .	0.193 .	0.276 .
T  2WNS.A.1             121    0.529 T	0.429 .	0.175 .	0.321 .	0.183 .	0.554 E	0.429 .	0.140 .	0.189 .	0.266 .
S  2WNS.A.1             122    0.524 T	0.427 .	0.326 .	0.409 .	0.408 .	0.534 E	0.312 .	0.122 .	0.169 .	0.248 .
G  2WNS.A.1             123    0.511 T	0.390 .	0.296 .	0.376 .	0.448 .	0.520 E	0.255 .	0.125 .	0.160 .	0.239 .
S  2WNS.A.1             124    0.323 .	0.264 .	0.298 .	0.346 .	0.441 .	0.393 .	0.156 .	0.111 .	0.152 .	0.225 .
S  2WNS.A.1             125    0.283 .	0.285 .	0.240 .	0.174 .	0.395 .	0.347 .	0.131 .	0.094 .	0.134 .	0.210 .
V  2WNS.A.1             126    0.227 .	0.240 .	0.116 .	0.096 .	0.172 .	0.305 .	0.106 .	0.098 .	0.129 .	0.197 .
L  2WNS.A.1             127    0.188 .	0.215 .	0.093 .	0.099 .	0.092 .	0.261 .	0.085 .	0.089 .	0.124 .	0.193 .
E  2WNS.A.1             128    0.179 .	0.202 .	0.101 .	0.101 .	0.088 .	0.246 .	0.098 .	0.082 .	0.115 .	0.194 .
T  2WNS.A.1             129    0.164 .	0.202 .	0.092 .	0.108 .	0.100 .	0.244 .	0.097 .	0.097 .	0.117 .	0.187 .
V  2WNS.A.1             130    0.160 .	0.196 .	0.087 .	0.091 .	0.094 .	0.234 .	0.103 .	0.108 .	0.115 .	0.182 .
E  2WNS.A.1             131    0.152 .	0.161 .	0.081 .	0.081 .	0.081 .	0.236 .	0.119 .	0.097 .	0.117 .	0.186 .
V  2WNS.A.1             132    0.141 .	0.170 .	0.078 .	0.087 .	0.078 .	0.217 .	0.101 .	0.107 .	0.118 .	0.185 .
L  2WNS.A.1             133    0.167 .	0.190 .	0.081 .	0.135 .	0.096 .	0.242 .	0.111 .	0.123 .	0.121 .	0.190 .
Q  2WNS.A.1             134    0.218 .	0.300 .	0.088 .	0.155 .	0.077 .	0.245 .	0.111 .	0.129 .	0.139 .	0.205 .
K  2WNS.A.1             135    0.227 .	0.317 .	0.136 .	0.196 .	0.124 .	0.241 .	0.101 .	0.158 .	0.194 .	0.220 .
E  2WNS.A.1             136    0.244 .	0.331 .	0.331 .	0.221 .	0.292 .	0.227 .	0.128 .	0.224 .	0.198 .	0.229 .
G  2WNS.A.1             137    0.233 .	0.316 .	0.296 .	0.199 .	0.296 .	0.221 .	0.166 .	0.197 .	0.208 .	0.231 .
L  2WNS.A.1             138    0.193 .	0.180 .	0.307 .	0.187 .	0.269 .	0.265 .	0.265 .	0.299 .	0.185 .	0.224 .
K  2WNS.A.1             139    0.169 .	0.141 .	0.293 .	0.152 .	0.213 .	0.224 .	0.264 .	0.222 .	0.147 .	0.208 .
V  2WNS.A.1             140    0.207 .	0.142 .	0.151 .	0.162 .	0.128 .	0.267 .	0.377 .	0.218 .	0.140 .	0.202 .
T  2WNS.A.1             141    0.191 .	0.089 .	0.128 .	0.144 .	0.107 .	0.233 .	0.344 .	0.178 .	0.128 .	0.204 .
D  2WNS.A.1             142    0.143 .	0.071 .	0.169 .	0.157 .	0.129 .	0.176 .	0.224 .	0.133 .	0.128 .	0.211 .
A  2WNS.A.1             143    0.147 .	0.069 .	0.181 .	0.157 .	0.142 .	0.183 .	0.207 .	0.138 .	0.122 .	0.216 .
I  2WNS.A.1             144    0.108 .	0.064 .	0.148 .	0.106 .	0.144 .	0.142 .	0.132 .	0.135 .	0.120 .	0.215 .
V  2WNS.A.1             145    0.103 .	0.064 .	0.138 .	0.098 .	0.125 .	0.190 .	0.130 .	0.135 .	0.116 .	0.223 .
L  2WNS.A.1             146    0.112 .	0.080 .	0.117 .	0.090 .	0.108 .	0.225 .	0.160 .	0.145 .	0.117 .	0.234 .
L  2WNS.A.1             147    0.159 .	0.108 .	0.110 .	0.111 .	0.115 .	0.278 .	0.216 .	0.183 .	0.125 .	0.276 .
D  2WNS.A.1             148    0.533 T	0.484 .	0.156 .	0.209 .	0.169 .	0.511 E	0.378 .	0.276 .	0.201 .	0.328 .
R  2WNS.A.1             149    0.566 T	0.556 A	0.218 .	0.251 .	0.201 .	0.533 E	0.402 .	0.343 .	0.385 .	0.378 .
E  2WNS.A.1             150    0.699 T	0.610 A	0.432 .	0.542 C	0.302 .	0.604 E	0.440 .	0.396 .	0.608 H	0.474 .
Q  2WNS.A.1             151    0.708 T	0.629 A	0.656 B	0.653 C	0.429 .	0.615 E	0.447 .	0.384 .	0.572 H	0.395 .
G  2WNS.A.1             152    0.605 T	0.534 A	0.578 B	0.606 C	0.474 .	0.568 E	0.400 .	0.251 .	0.500 H	0.348 .
G  2WNS.A.1             153    0.556 T	0.457 .	0.557 B	0.641 C	0.460 .	0.550 E	0.365 .	0.196 .	0.384 .	0.295 .
K  2WNS.A.1             154    0.353 .	0.323 .	0.430 .	0.418 .	0.419 .	0.433 .	0.278 .	0.132 .	0.170 .	0.223 .
D  2WNS.A.1             155    0.280 .	0.286 .	0.148 .	0.200 .	0.286 .	0.373 .	0.310 .	0.109 .	0.152 .	0.219 .
K  2WNS.A.1             156    0.257 .	0.289 .	0.107 .	0.158 .	0.128 .	0.353 .	0.293 .	0.110 .	0.155 .	0.206 .
L  2WNS.A.1             157    0.312 .	0.424 .	0.107 .	0.197 .	0.141 .	0.354 .	0.279 .	0.147 .	0.177 .	0.211 .
Q  2WNS.A.1             158    0.384 .	0.483 .	0.119 .	0.228 .	0.135 .	0.378 .	0.332 .	0.154 .	0.177 .	0.220 .
A  2WNS.A.1             159    0.398 .	0.536 A	0.217 .	0.320 .	0.273 .	0.378 .	0.264 .	0.189 .	0.269 .	0.242 .
H  2WNS.A.1             160    0.425 .	0.554 A	0.244 .	0.334 .	0.350 .	0.389 .	0.367 .	0.234 .	0.251 .	0.251 .
G  2WNS.A.1             161    0.397 .	0.513 A	0.234 .	0.279 .	0.336 .	0.332 .	0.325 .	0.528 G	0.348 .	0.277 .
I  2WNS.A.1             162    0.290 .	0.367 .	0.243 .	0.276 .	0.319 .	0.321 .	0.361 .	0.557 G	0.314 .	0.258 .
R  2WNS.A.1             163    0.211 .	0.187 .	0.138 .	0.170 .	0.209 .	0.301 .	0.336 .	0.536 G	0.220 .	0.231 .
L  2WNS.A.1             164    0.202 .	0.160 .	0.112 .	0.137 .	0.135 .	0.273 .	0.321 .	0.605 G	0.225 .	0.226 .
H  2WNS.A.1             165    0.186 .	0.122 .	0.105 .	0.134 .	0.103 .	0.265 .	0.344 .	0.198 .	0.135 .	0.208 .
S  2WNS.A.1             166    0.220 .	0.110 .	0.100 .	0.108 .	0.100 .	0.244 .	0.540 F	0.191 .	0.130 .	0.213 .
V  2WNS.A.1             167    0.203 .	0.104 .	0.099 .	0.109 .	0.099 .	0.232 .	0.557 F	0.168 .	0.135 .	0.227 .
C  2WNS.A.1             168    0.182 .	0.103 .	0.102 .	0.110 .	0.117 .	0.234 .	0.564 F	0.149 .	0.122 .	0.230 .
T  2WNS.A.1             169    0.239 .	0.178 .	0.101 .	0.112 .	0.174 .	0.303 .	0.578 F	0.158 .	0.145 .	0.255 .
L  2WNS.A.1             170    0.291 .	0.262 .	0.111 .	0.177 .	0.215 .	0.349 .	0.396 .	0.181 .	0.177 .	0.276 .
S  2WNS.A.1             171    0.258 .	0.281 .	0.108 .	0.187 .	0.189 .	0.356 .	0.350 .	0.158 .	0.180 .	0.267 .
K  2WNS.A.1             172    0.289 .	0.311 .	0.108 .	0.192 .	0.180 .	0.368 .	0.370 .	0.164 .	0.202 .	0.265 .
M  2WNS.A.1             173    0.299 .	0.309 .	0.112 .	0.207 .	0.142 .	0.360 .	0.389 .	0.133 .	0.201 .	0.237 .
L  2WNS.A.1             174    0.208 .	0.231 .	0.109 .	0.153 .	0.083 .	0.301 .	0.176 .	0.128 .	0.171 .	0.207 .
E  2WNS.A.1             175    0.187 .	0.211 .	0.103 .	0.120 .	0.072 .	0.264 .	0.123 .	0.129 .	0.163 .	0.205 .
I  2WNS.A.1             176    0.164 .	0.192 .	0.098 .	0.122 .	0.079 .	0.243 .	0.129 .	0.121 .	0.145 .	0.194 .
L  2WNS.A.1             177    0.205 .	0.267 .	0.116 .	0.180 .	0.083 .	0.291 .	0.145 .	0.144 .	0.128 .	0.186 .
E  2WNS.A.1             178    0.269 .	0.385 .	0.152 .	0.165 .	0.080 .	0.331 .	0.191 .	0.138 .	0.139 .	0.193 .
Q  2WNS.A.1             179    0.294 .	0.389 .	0.223 .	0.180 .	0.141 .	0.367 .	0.206 .	0.269 .	0.223 .	0.210 .
Q  2WNS.A.1             180    0.425 .	0.521 A	0.283 .	0.193 .	0.301 .	0.416 .	0.327 .	0.325 .	0.246 .	0.224 .
K  2WNS.A.1             181    0.611 T	0.510 A	0.282 .	0.205 .	0.261 .	0.443 .	0.738 F	0.339 .	0.223 .	0.244 .
K  2WNS.A.1             182    0.619 T	0.423 .	0.222 .	0.223 .	0.249 .	0.412 .	0.761 F	0.383 .	0.240 .	0.262 .
V  2WNS.A.1             183    0.595 T	0.394 .	0.173 .	0.203 .	0.257 .	0.373 .	0.745 F	0.282 .	0.208 .	0.249 .
D  2WNS.A.1             184    0.530 T	0.355 .	0.156 .	0.282 .	0.197 .	0.396 .	0.748 F	0.193 .	0.200 .	0.235 .
A  2WNS.A.1             185    0.328 .	0.339 .	0.162 .	0.276 .	0.208 .	0.360 .	0.315 .	0.166 .	0.211 .	0.223 .
E  2WNS.A.1             186    0.303 .	0.338 .	0.177 .	0.240 .	0.211 .	0.348 .	0.225 .	0.138 .	0.183 .	0.215 .
T  2WNS.A.1             187    0.341 .	0.344 .	0.161 .	0.242 .	0.161 .	0.349 .	0.227 .	0.162 .	0.196 .	0.206 .
V  2WNS.A.1             188    0.251 .	0.280 .	0.116 .	0.158 .	0.117 .	0.299 .	0.224 .	0.161 .	0.148 .	0.196 .
G  2WNS.A.1             189    0.176 .	0.179 .	0.085 .	0.097 .	0.089 .	0.274 .	0.156 .	0.134 .	0.141 .	0.193 .
R  2WNS.A.1             190    0.166 .	0.185 .	0.078 .	0.094 .	0.080 .	0.262 .	0.124 .	0.132 .	0.145 .	0.188 .
V  2WNS.A.1             191    0.172 .	0.186 .	0.084 .	0.117 .	0.086 .	0.267 .	0.113 .	0.111 .	0.120 .	0.181 .
K  2WNS.A.1             192    0.182 .	0.184 .	0.088 .	0.118 .	0.083 .	0.285 .	0.108 .	0.126 .	0.113 .	0.175 .
R  2WNS.A.1             193    0.222 .	0.251 .	0.080 .	0.113 .	0.079 .	0.298 .	0.106 .	0.138 .	0.111 .	0.173 .
F  2WNS.A.1             194    0.295 .	0.325 .	0.089 .	0.137 .	0.074 .	0.360 .	0.108 .	0.159 .	0.109 .	0.169 .
I  2WNS.A.1             195    0.310 .	0.329 .	0.120 .	0.155 .	0.071 .	0.363 .	0.136 .	0.178 .	0.113 .	0.177 .
Q  2WNS.A.1             196    0.300 .	0.335 .	0.127 .	0.150 .	0.069 .	0.337 .	0.116 .	0.118 .	0.112 .	0.187 .
E  2WNS.A.1             197    0.288 .	0.307 .	0.165 .	0.171 .	0.089 .	0.350 .	0.084 .	0.126 .	0.150 .	0.210 .





CORRESPONDENCE

Thomas Nordahl Petersen,