The CBS web site is under hardware upgrade. Please report broken functionality to webmaster@cbs.dtu.dk. For a quick fix, replace 'www' with 'genome' in CBS URLs.
Events News Research CBS CBS Publications Bioinformatics
Staff Contact About Internal CBS CBS Other

Output format



DESCRIPTION

For each input sequence the following is shown (see the example below):
  • Header line, quoting the name and length of the sequence.

  • Sequence, in one-letter code, as it was interpreted by the server.

  • Annotation overview, showing the predictions residue by residue, as follows:

    . (dot) neutral place-holder
    s predicted to be within a signal peptide
    P predicted to be followed by a propeptide cleavage site

  • Prediction score table, quoting the position, context and score for each arginine (R) and lysine (K) residue in the sequence.

    If the score is >0.5 the residue is predicted to be followed by a propeptide cleavage site; the higher the score the more confident the prediction.

  • Graph, in GIF, illustrating the predictions.

    For each arginine (R) and lysine (K) the prediction score is plotted against the position in the sequence. If a signal peptide cleavage site has been predicted it is also shown in the graph.

The example below shows the output for glial cell line-derived neurotrophic factor precursor (ATF-1), taken from the Swiss-Prot entry GDNF_HUMAN. The signal peptide prediction is consistent with the database annotation. Two propeptide cleavage sites are predicted; one of them (pos. 77-78) is annotated in the database. The other prediction (pos. 168-169) is false.

EXAMPLE OUTPUT


         ##### ProP v.1.0b ProPeptide Cleavage Site Prediction #####


         ##### Furin-type cleavage site prediction (Arginine/Lysine residues) #####


  211 GDNF_HUMAN  
MKLWDVVAVCLVLLHTASAFPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMPEDYPDQFDDVMDFIQATIKRLKRSPD      80
KQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKIL     160
KNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI                                  240
sssssssssssssssssss.........................................................P...      80
................................................................................     160
.......P...........................................                                  240
 
Signal peptide cleavage site predicted:	between pos. 19 and 20: ASA-FP
 
Propeptide cleavage sites predicted:	Arg(R)/Lys(K): 2




Name           Pos    Context     Score  Pred
____________________________v_________________
GDNF_HUMAN       2    -----MK|LW  0.069    .
GDNF_HUMAN      26    FPLPAGK|RP  0.054    .
GDNF_HUMAN      27    PLPAGKR|PP  0.120    .
GDNF_HUMAN      36    EAPAEDR|SL  0.134    .
GDNF_HUMAN      40    EDRSLGR|RR  0.074    .
GDNF_HUMAN      41    DRSLGRR|RA  0.163    .
GDNF_HUMAN      42    RSLGRRR|AP  0.124    .
GDNF_HUMAN      73    FIQATIK|RL  0.059    .
GDNF_HUMAN      74    IQATIKR|LK  0.140    .
GDNF_HUMAN      76    ATIKRLK|RS  0.062    .
GDNF_HUMAN      77    TIKRLKR|SP  0.802 *ProP*
GDNF_HUMAN      81    LKRSPDK|QM  0.062    .
GDNF_HUMAN      88    QMAVLPR|RE  0.090    .
GDNF_HUMAN      89    MAVLPRR|ER  0.108    .
GDNF_HUMAN      91    VLPRRER|NR  0.146    .
GDNF_HUMAN      93    PRRERNR|QA  0.152    .
GDNF_HUMAN     104    ANPENSR|GK  0.088    .
GDNF_HUMAN     106    PENSRGK|GR  0.071    .
GDNF_HUMAN     108    NSRGKGR|RG  0.099    .
GDNF_HUMAN     109    SRGKGRR|GQ  0.254    .
GDNF_HUMAN     112    KGRRGQR|GK  0.251    .
GDNF_HUMAN     114    RRGQRGK|NR  0.091    .
GDNF_HUMAN     116    GQRGKNR|GC  0.095    .
GDNF_HUMAN     137    GLGYETK|EE  0.058    .
GDNF_HUMAN     143    KEELIFR|YC  0.112    .
GDNF_HUMAN     158    AETTYDK|IL  0.054    .
GDNF_HUMAN     161    TYDKILK|NL  0.067    .
GDNF_HUMAN     165    ILKNLSR|NR  0.072    .
GDNF_HUMAN     167    KNLSRNR|RL  0.070    .
GDNF_HUMAN     168    NLSRNRR|LV  0.767 *ProP*
GDNF_HUMAN     173    RRLVSDK|VG  0.064    .
GDNF_HUMAN     180    VGQACCR|PI  0.080    .
GDNF_HUMAN     201    LVYHILR|KH  0.093    .
GDNF_HUMAN     202    VYHILRK|HS  0.074    .
GDNF_HUMAN     206    LRKHSAK|RC  0.095    .
GDNF_HUMAN     207    RKHSAKR|CG  0.222    .
____________________________^_________________









GETTING HELP

Scientific problems:        Technical problems: