Example of three sequences in FASTA format


>seq1
MDKSSIANKIEAYLGAKSDDSKIDQSLKADPSEVQYYGSGGDGYYLRKNICKITVNHSDSGTNDPCDRIPPPYGDNDQWKCAIILSKVSEKPENVFVPPRRQRMCINNLEKLNVDKIRDKHAFLADVLLTARNEGERIVQNHPDTNSSNVCNALERSFADIADIIRGTDLWKGTNSNLEQNLKQMFAKIRENDKVLQDKYPKDQNYRKLREDWWNANRQKVWEVITCGARSNDLLIKRGWRTSGKSNGDNKLELCRKCGHYEEKVPTKLDYVPQFLRWLTEWIEDFYREKQNLIDDMERHREECTSEDHKSKEGTSYCSTCKDKCKKYCECVKKWKSEWENQKNKYTELYQQNKNETSQKNTSRYDDYVKDFFKKLEANYSSLENYIKGDPYFAEYATKLSFILNSSDANNPSEKIQKNNDEVCNCNESGIASVEQEQISDPSSNKTCITHSSIKANKKKVCKHVKLGVRENDKDLRVCVIEHTSLSGVENCCCQDFLRILQENCSDNKSGSSSNGSCNNKNQEACEKNLEKVLASLTNCYKCDKCKSEQSKKNNKNWIWKKSSGKEGGLQKEYANTIGLPPRTQSLCLVVCLDEKGKKTQELKNIRTNSELLKEWIIAAFHEGKNLKPSHEKKNDDNGKKLCKALEYSFADYGDLIKGTSIWDNEYTKDLELNLQKIFGKLFRKYIKKNNTAEQDTSYSSLDELRESWWNTNKKYIWLAMKHGAGMNSTTCCGDGSVTGSGSSCDDIPTIDLIPQYLRFLQEWVEHFCKQRQEKVKPVIENCKSCKESGGTCNGECKTECKNKCEVYKKFIEDCKGGDGTAGSSWVKRWDQIYKRYSKYIEDAKRNRKAGTKNCGPSSTTNAAENKCVQSDIDSFFKHLIDIGLTTPSSYLSIVLDDNICGADKAPWTTYTTYTTTEKCNKETDKSKLQQCNTAVVVNVPSPLGNTPHGYKYACQCKIPTNEETCDDRKEYMNQWSCGSARTMKRGYKNDNYELCKYNGVDVKPTTVRSNSSKLDDKDVTFFNLFEQWNKEIQYQIEQYMTNTKISCNNEKNVLSRVSDEAAQPKFSDNERDRNSITHEDKNCKEKCKCYSLWIEKINDQWDKQKDNYNKFQRKQIYDANKGSQNKKVVSLSNFLFFSCWEEYIQKYFNGDWSKIKNIGSDTFEFLIKKCGNDSGDGETIFSEKLNNAEKKCKENESTNNKMKSSETSCDCSEPIYIRGCQPKIYDGKIFPGKGGEKQWICKDTIIHGDTNGACIPPRTQNLCVGELWDKRYGGRSNIKNDTKESLKQKIKNAIQKETELLYEYHDKGTAIISRNPMKGQKEKEEKNNDSNGLPKGFCHAVQRSFIDYKNMILGTSVNIYEYIGKLQEDIKKIIEKGTTKQNGKTVGSGAENVNAWWKGIEGEMWDAVRCAITKINKKQKKNGTFSIDECGIFPPTGNDEDQSVSWFKEWSEQFCIERLQYEKNIRDACTNNGQGDKIQGDCKRKCEEYKKYISEKKQEWDKQKTKYENKYVGKSASDLLKENYPECISANFDFIFNDNIEYKTYYPYGDYSSICSCEQVKYYEYNNAEKKNNKSLCHEKGNDRTWSKKYIKKLENGRTLEGVYVPPRRQQLCLYELFPIIIKNKNDITNAKKELLETLQIVAEREAYYLWKQYHAHNDTTYLAHKKACCAIRGSFYDLEDIIKGNDLVHDEYTKYIDSKLNEIFDSSNKNDIETKRARTDWWENEAIAVPNITGANKSDPKTIRQLVWDAMQSGVRKAIDEEKEKKKPNENFPPCMGVQHIGIAKPQFIRWLEEWTNEFCEKYTKYFEDMKSNCNLRKGADDCDDNSNIECKKACANYTNWLNPKRIEWNGMSNYYNKIYRKSNKESEDGKDYSMIMEPTVIDYLNKRCNGEINGNYICCSCKNIGENSTSGTVNKKLQKKETQCEDNKGPLDLMNKVLNKMDPKYSEHKMKCTEVYLEHVEEQLKEIDNAIKDYKLYPLDRCFDDKSKMKVCDLIGDAIGCKHKTKLDELDEWNDVDMRDPYNKYKGVLIPPRRRQLCFSRIVRGPANLRNLKEFKEEILKGAQSEGKFLGNYYNEDKDKEKALEAMKNSFYDYEYIIKGSDMLTNIQFKDIKRKLDRLLEKETNNTEKVDDWWETNKKSIWNAMLCGYKKSGNKIIDPSWCTIPTTETPPQFLRWIKEWGTNVCIQKEEHKEYVKSKCSNVTNLGAQESESKNCTSEIKKYQEWSRKRSIQWEAISEGYKKYKGMDEFKNTFKNIKEPDANEPNANEYLKKHCSKCPCGFNDMQEITKYTNIGNEAFKQIKEQVDIPAELEDVIYRLKHHEYDKGNDYICNKYKNINVNMKKNNDDTWTDLVKNSSDINKGVLLPPRRKNLFLKIDESDICKYKRDPKLFKDFIYSSAISEVERLKKVYGEAKTKVVHAMKYSFADIGSIIKGDDMMENNSSDKIGKILGDGVGQNEKRKKWWDMNKYHIWESMLCGYKHAYGNISENDRKMLDIPNNDDEHQFLRWFQEWTENFCTKRNELYENMVTACNSAKCNTSNGSVDKKECTEACKNYSNFILIKKKEYQSLNSQYDMNYKETKAEKKESPEYFKDKCNGECSCLSEYFKDETRWKNPYETLDDTEVKNNCMCKPPPPASNNTSDILQKTIPFGIALALGSIAFLFMKKKPKTPVDLLRVLDIPKGDYGIPTPKSSNRYIPYASDRYKGKTYIYMEGDTSGDDDKYIWDLSSSDITSSESEYEEVDINDIYVPSFPKYKTFIELVLEPSKRDTFNTSSGDTFTNKLTDDEWNQLKQDFIEQYLQNIQKDFILHDSMDEKPFITQIQDRFLDSSHEEVTYNIDWNVPENINRITNNMDDPKYCSNNMYTGTDLINDSLNGNQYIDIYDEMLKRKENELFGTYHTKYTTFNSVSKQTPSDPIINQLDLYHKWIDKHRDICEQWKTKEDMLYKLNEVWNMERKEYLLDIQPSTLDDIHKINDETYNIISTNNIYDHPSQETPLQLLGSTNIIPSYITTEQNNGLRTNISMDTYIDETNNNNVVATSIIGDDQMENSYNC
>seq2
MVPPGGRQGGSGEDGIDDKDAKHLLDSIGKIVHEQVKNDAKTYKGELEGKLSLATTIGELNYTKDPCIFDYSKLINGSGSGGVTARDDPCGNGSGKGEDV
SRFSDKEGAQCANSKIHGNSKGSNGGACAPLRRLHLCNKNMEKIATSTAKHDLLVDVCMAANYEAQSLIRDHPQHKRTNPDSKICTELARSFADIGDIVR
GRDLYRGNKKENKQREKLEENLRKIFENIYEGLSNNGVKARYEGDKENFYQLREDWWALNRDQVWKALTCSDDLKDASYFRPTCSDRKGSCSQAKDNCRC
DGSNTDQVPTYFDYVPQFLRWFEEWAEDFCRKKKKKLEKLEQQCRGVYEGKERYCSRNGFDCEKTVNARGKVRMGKGCTDCFFACNPYIDWIEKQKEQFD
KQKQKYDEEIKKYTKVASSSSGGRAKRAARGGSNVNGYEKIFYKKLKDSGYESVGEFLDLLSKEEVCKNFKEKEEGKIDFKTVKSSSAKNSDDSNKTFCR
TKYCQPCPLCGMKKNNNGEWEHKKKGKCTSGNLYRPIDGAIHTDINFLYSGDRHDDIEKKLNRFCDETNGDTINSVAGVSGTGVVAGSNSRSKELYQEWK
CYKGKDVEKVKDGKDEDDEDYEDDYHKEVENAGGLCILENNDGKEKVNKQKTYNDFFYYWVAHMLKDSIHWKKKLEKCLKNGTKTRCKNNKCNRECGCFQ
KWVEQKKKKEWGKIIEHFYKQEGIPPGTHDITLEGVLKKEVLLTSLQEGYGNAEDIEHIKQLLEEEENEENEGTPGADNKNKNTIDKLLDHEEGIAKECQ
QKQNECPKKPPKKTPGGPDRALKPEEVDASSEDHYDEEGGEDEEEEEDKEEEGEDGEDVQDDVAEEDTAKEEGSSTTETQLPDACNIVKTLFESTKNFED
ACRQKYGPKAPTSWKCVPTTGDKDGATGKSDGSICVPPRRRRLYIHKVDDNVKDDASLRKWFIESSAVETFFLWHEYKMEKKREDIEKQKANEKVVDTSN
VGEELQNDLEGNGTIPEEFKRQMFYTLGDYKDIFEGKSIEVGDEKDKQKMKEIEKKIQAHINSGSSSPPHGTPGQPNSVTTPQQTWWSRNAPSIWKGMIC
ALTYKEDGEKSTDDKTTLKRNDDVYEKIFGKPPNNDNPQNPNNGTFHKKYHYDSVRLKDDDDQSGDKLQSTSAPSDTPTLNNPKLSDFVLRPTYFRYLEE
WGESFCGTRKRMLEQLEKVCRSGETGKEHCSGDGHVCEKDYLNHNNMFADSYCPDCKKACRKYKKWIEKKLEEFQKQKDKYKGELDKLTKDKSGGDKKFC
EEIKNHSSAANFLKELKHGKDNQGNSDQDNKLDFENIPQTFSRSTYCKTCPPNKVNCSSGSKSRTSGGTNRCTEVKKNGETWEKVFDKIAKNNGKTTTID
VHMIDRRAPFIKKYLENSKNSEESNNSLFKDSYLFKSVRDQNWECKFENENKDVCKLKNFNDKIDLNQYTTFKVLLIYWLEDFIEGYYILKKRKVFEQCK
ENGENTCSEESKNYCACVKVWLEKKKNEWDQIKKHFKDRKSDDGDTVVSKVRNFLETLIPRIAPKKNNGEVTELSDLEKSLGCNCAGRAENSKEDEKEDV
VLCLLTKLEDKANKCKEDQKPNGENQAQTCEKSAPVEDEDDEPLEEENPVTQPNICPKVETTEETVDEGKCEEDTVTPSLGPKDDSEKDEKKEENSEDTT
AAEGEENGAPGSSGTPPPPPAAPPSTPAKTKESKKPKSTKKPRIKTLNVLDHPAVIPALMSSTIMWSIGIGFATFTYFYLKKKTKSSVRNLFQILQIPKG
DYDIPTKLSPNRYIPYTSGKYRGKRYIYLEGDSGTDSGYTDHYSDITSSESEYEEMDINDIYVPGSPKYKTLIEVVLEPSKSNGNTLGDDMVPTTNTFTD
EEWNELKHDFISNMLQNQPNDYKSEDIPLNTQPNTLYFNKPEEKPFITSIHDRNLYSGEEYSYNINMSTNSMDDIPINRDNNVYSGIDLINDTLSGNQHI
DIYDEVLKRKENELFGTKHHTKRTSTQNVAKPARDDPIHNQLDLFHKWLDRHRDMCKKWNNKEGLLDKLKEEWNKDTNSGKLSDNIHSDNKPGDIPSDNH
VLNSDVSIQIDMGNPKYINQFTCVDSNPNLTLRSNPNLMGNQNPNLNLVENNINPNHQNQNQVGDTNFVDTPTNPTNVQIEMDVNTKLVKEKYPIGDVWDI
>seq3
MGSQGSKPVDTSDVKNESHNSARNVFENIAEIIYNRVKEDAEKRGKSLKGDYKRAKFHQPLLEAAKYVWYAPSNPCNFDFRFDTNAPDKGSYDRDPCHLRDTNRFSDKGDAICTNNKINCNNGGCGACAPYRRIQLCDYNLEYINEYNINSTHDLLGNLLVMAKREGDSIVNSHGHTGKGIYKSGICTSLARSFADIGDIIRGKDLFLGHNHKKKPLLDNLEKIFNRFQKIYEDINNLPIDDIREYWWALNRNDVWEALTCSAPYYADYFKKKSGNTYNFTTEGYCGRNEGAPPTNLDYVPQFLRWFDEWAEEFCRIKNIKIGNIKKSCTGESNNKHCSREGYDCNKTNLRLNEIFMDLECPRCADDCKSYETWVENKKKEFNKQKEKYKEEINESKPGVNSEHGKYNKAFYDKLRTIYRTNDKFFEILNKGQICENVDEKNKIDFNDLVKTFSRSEYCKSCPMLGVTCKGEQCNSLDDITCTNDKGGPNKVTDKNNNTFVIDILLNDNKKKVLSNDLNDYKECDLFKRLRRQNWNCKYKCNLHVCELNNFNNEIDDERVISIKVFIKRWLESFLKDYNKLKENLNPCINNENQLPCIKDCLENCDCVEKWIKKKGEEWKKIKERYLKDYKIEDNNSSNSLNKFLQQNQFHSDVVKAIKPFENLRAFEDSSGCTGTVPSGIEECKSNDVIKILLSKLKEKIELCKKNDVKKNKSNNCVTLLKPLNDEEDDEEQDDEPPAPKPLPTPNPCVNGGDDTSGAQITSVTEIAEGMHMGAQKQMLERSGDKSGKGTENGESVLKGDIKKAKFKNGASPSSLEDVCGITDQHTKDSRRRRRLRRLRLLVLRFRRRLRRGHRDYKGPCTGKDGHKKMFQVEKGWENGSKIGTENDVFLPPRREHFCTSNVEHLYRSASGLQGTTASHSLLGDVLLAANKEAGFIKERYKTQKTSEGFKDEATVCRAIKYSFADIADIIKGTDLWKANSGKKNTQDKLVKIFQKIKDNLPVNIKGKYNEDEKHLELRKDWWFANRDKVWEAMKCEQNGITCSGPTPLDDYIPQRLRWMTEWAEWYCKAQKEAYDKLKVCEKCMDNGKCTQGNGECAKCKTACENYKKFINTWQPQWKQMEQKYESLYKEAQENGNSSHKSTTEQDKYMVEFLSQLQKANNGDKTGDDKVYSTAAGYVHQEATMNCEKQTQFCKNKNGVKAANDAEDVNYTFKDTPNGYDVVCKCKDRPEQQIKKKEVEDACKIAQDIFKGKDENTTVGLCKKKDFGRTPYPDWKCEKNSKLVTGNGECMPPRRQKLCLYFLAHKIETPNLNTQEDLRKAFIKCAAAETFFSWYYFKKINDKLNKLDEKLKEGEIPPQFLRSMFYTFGDYKDICLDTDISLKTENGDITKAKSNIDRIIPKKSAKNPDEERKIWWDGIKEDVWEGMLCGLSHAVSNNDKATVQKTLTTKTIYDYDTVTFDGTTKLEDFSKRPQFLRWMTEWGEEFCKKRKEQLENLKDKCPDYTCSFDTKKQECENHCKVYEEWLKGWKDQYKKQSEKFTTDKEKPEYKDDPDVASSENAHKYLSKKLKQIFHNGSTTEKCDYTCMEYASRQPQTSACSQQQQQQNKSSTQNHFPEAFDYPPKEIGDRCTCPKLPEPKYCVDKTAYDIRKESGKKSDNSLKGNGNTYNNNCNNSMREEYANQNGETCKFNETFWSKKKPSIEECDINAKERFQIQKYWDCNGKTPDGKNTFCIPPRRKDMCLKQLEEINSADVNNSKKLLQKIQDVAKKEGDDIIKKLLPKYPCNEDVICKAMKYSFADLADIVRGIDKYKGPNGTNVLEKELKSVFETIYTKWKSENTNNKSKYTDVASFRSAWWDANRKDIWNAMTCNAPYDAKIYITKEGGYISPLTFTKNKCGHNDDPPDYDYIPQPFRWLSEWSETYCLAQKDLLETMKNCENCMKKNKNADCEQTQYGACRDCKRKCEEYKKFIEIWKKQFETQNKAYQEIYRNATTTNRDNNNIVDENTKNFVKKLQENCRTDRNESLDTADKYLENASVCRRFKFGNKDSRHLNYAFHTDPPSYEEHCKCAKDFDPLDECPVDNNECKKYGIGSCPKKNFHKKLEEWTNYVLNNKSNKNKSAIVPPRRRQLCLQNLTRNLSRLNKEKSFKEGILISAASEAKMLTEQYRENPAKALQAIKYSFADIGNIIKGDDIIGNVISVQLNKLINGNKKINTSTLWWEANKEKIWNAMMCYYTGDEKTATSCPSHGNIDKEDQFLLWFQEWGENFCARQKELYEHVQAECSHVICVNGTGNIDSKCTEACKNYSNFISETKNVYQSLKKQYNDNHNSIKVGGKEVHHYMKEKCKDKCECLSEKFNSDNNWEKPYDTFDDTVLKNKCQCKKPDSPILPVEPSVPAETEKEKKKDSPLKPHTEPKPAPPKKPEVPPPPPVQPPPANQPFNRDILEKTIPFGIALALGSIAFLFIKKKPKSPVDLIRVLDIHKGDYGMPTLKSKNRYIPYASDTYKGKTYIYMEGDSDSGHYYEDTTDITSSESEYEEMDINDIYVPDSPKYKTLIEVVLEPSKRDTPSSDAPMNKFTDDEWNQLKQDFISGILENEQKDLPKNNISGNTPMNTQPNTLYFNKPEEKPFITSIHDRDLYSGEEINYNINMSTNSMDDTSYVSNNVYSGIDLINDTLSGNQHIDIYDEVLKRKENELFGTNYKKNTSNNNVAKLTNSDPIMNQLDLLHKWLDRHRDMCEKWKSKEDILHKLNEQWNKDNDGGNVPIDNRSLNTDVWIEIDMDDPKGKKEFSNMDTILDDIEDDIYYDVNDDENPSVDNIPMDHNKVDVPKKVHVEMKILNNTSNGSLEPEFPISDVWNI




Please note that empty lines are not accepted.

Detailed description of the FASTA format is available at NCBI.