Events News Research CBS CBS Publications Bioinformatics
Staff Contact About Internal CBS CBS Other

Output format

Follooing translation Virtual Ribosome produces a visualization of DNA, peptide, START and STOP codon, position of transcript and offers the translated sequences in FASTA and TAB format.

Please refer to the instructions for a detailed description of the visualization.

FASTA

Example:
>GOTHBAII_745
MVLSAADKSNVKAAWGKVGSNAGAYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG
EKVAAALTKAVGHLDDLPGTLSDLSDLHAHKLRVDPVNFKLLSHSLLVTLACHHPSDFTP
AVHASLDKFLANVSTVLTSKYR*

TAB format

This format only makes sense in the input DNA sequences were also in TAB format containing information about Intron/Exon structure. A description is found in the Instructions page: TAB format. Examples of output is found here: Derived sequence annotation.


GETTING HELP

Scientific and technical problems: