Events News Research CBS CBS Publications Bioinformatics
Staff Contact About Internal CBS CBS Other

YinOYang 1.2 output format


Name:  HXA3_HUMAN       Length:  443
(sequence)
MQKATYYDSSAIYGGYPYQAANGFAYNANQQPYPASAALGADGEYHRPACSLQSPSSAGGHPKAHELSEACLRTLSAPPS      80
QPPSLGEPPLHPPPPQAAPPAPQPPQPAPQPPAPTPAAPPPPSSASPPQNASNNPTPANAAKSPLLNSPTVAKQIFPWMK     160
ESRQNTKQKTSSSSSGESCAGDKSPPGQASSKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQ     240
NRRMKYKKDQKGKGMLTSSGGQSPSRSPVPPGAGGYLNSMHSLVNSVPYEPQSPPPFSKPPQGTYGLPPASYPASLPSCA     320
PPPPPQKRYTAAGAGAGGTPDYDPHAHGLQGNGSYGTPHIQGSPVFVGGSYVEPMSNSGPALFGLTHLPHAASGAMDYGG     400
AGPLGSGHHHGPGPGEPHPTYTDLTGHHPSQGRIQEAPKLTHL
(annotation line, G=O-GlcNAc, Y=YinYang)
...................................G...................GY..................G...G      80
..................................Y.......GG.Y.....G...G........................     160
.....Y...GYYY..........Y.....Y.....G..G.........................................     240
................G.Y...Y.G...........................Y....G.....G......G...G..G..     320
........................................................................G.......     400
........................................G..

-------------------------------------------------------------------------------
SeqName     Residue  O-GlcNAc  Potential  Thresh.  Thresh.   NetPhos  YinOYang?
                      result   (o-glcnac)   (1)      (2)    potential
                                                          (Thresh=0.5)
-------------------------------------------------------------------------------
HXA3_HUMAN     5  T    -        0.4047    0.4125   0.5064     <-- A negative site    
HXA3_HUMAN     9  S    -        0.4267    0.4631   0.5746            
HXA3_HUMAN    10  S    -        0.3548    0.4653   0.5776            
HXA3_HUMAN    36  S    ++       0.5781    0.4421   0.5463     <-- O-GlcNAc predicted (++)       
HXA3_HUMAN    51  S    -        0.4089    0.4299   0.5298            
HXA3_HUMAN    54  S    -        0.3183    0.3966   0.4849     0.783  <- Phos,No-GlcNAc
HXA3_HUMAN    56  S    +        0.4483    0.3792   0.4615            
HXA3_HUMAN    57  S*   +        0.4357    0.3856   0.4702     0.967       * <- YinYang
HXA3_HUMAN    68  S    -        0.2631    0.4479   0.5542            
HXA3_HUMAN    74  T    -        0.3126    0.4422   0.5464            
HXA3_HUMAN    76  S    ++       0.5023    0.3922   0.4791            
HXA3_HUMAN    80  S    +++      0.6007    0.3667   0.4447            
HXA3_HUMAN    84  S    -        0.2640    0.3769   0.4584     0.991       
HXA3_HUMAN   115  T*   +++      0.6261    0.3591   0.4344     0.770       * <- YinYang
.
.
.
-------------------------------------------------------------------------------

O-GlcNAc Result
This can be one of 5 possibles:-

   -  No O-GlcNAc predicted

O-GlcNAc predicted: (different strengths)
   +  Potential > Thresh-1
  ++  Potential > Thresh-2          (Thresh-2 is a threshold based on more stringent surface measures)
 +++  Potential > (Thresh-2 + 0.1)
++++  Potential > (Thresh-2 + 0.1) AND Potential >= 0.75

NetPhos
These potentials are displayed if 'YinYang' output was selected and if the NetPhos potential
crosses the NetPhos (fixed) threshold.
Predictions are run in parallel from the NetPhos server.

YinOYang
Ser/Thr residues which are predicted to be O-GlcNAcylated as well as phosphorylated are
marked by an asterisk (*) in both the residue and the YinOYang column. Such sites may be
reversibly and dynamically modified by O-GlcNAc or Phosphate groups at different times
in the cell.

SignalP
With all predictions, the SignalP server is run in parallel. If a sequence is predicted to contain
a signal peptide, a warning is displayed. Such sequences are unlikely to be intracellular, and hence
unlikely to be O-GlcNAcylated.

Graph
The figure illustrates O-GlcNAc and NetPhos predictions across the length of the sequence.
The x-axis represents the sequence from N-terminal to C-terminal. Vertical impulses (green)
are O-GlcNAc potentials. For predicted O-GlcNAcylated sites, these potentials would cross
the threshold (blue wavy horizontal) line.
Small red marks/circles on the green impulses indicate YinYang sites.






GETTING HELP

Scientific problems:        Technical problems: