Events News Research CBS CBS Publications Bioinformatics
Staff Contact About Internal CBS CBS Other



Example of two sequences in FASTA format


>seq1
ASTPGHTIIYEAVCLHNDRTTIP
>seq2 optional comment
ASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPK
NMYKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGR
KSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARRELVISLIVES


Please note that empty lines are not accepted, all sequences must have a name and no intervening characters are allowed between the initial ">" and the sequence name on the header line.

Detailed description of the FASTA format is available at NCBI.


GETTING HELP

Kristoffer Rapacki,