Quiz
 

Consider the following partial amino acid sequence of a protein:

MTEVLRNSPYRCDISSLNSPDAEWRKVIFKAIDESLSKKMGRTQ

How would you go about finding the DNA sequence for this?
 
 

 Link to today's LECTURE notes if you're interested....
 

 
 
 
 Calvin & Hobbes Mexican worms
Hey! These sumptious worms might have genetically modified!  I guess we can't eat them.  (too bad!)
 
 
 
 
Single-letter abbreviations of amino acids

 
The Genetic Code
as used by nearly all eukaryotic nuclear genomes


 

 
 
 
To get a nice, handy-dandy box like this:
 
 
use the following web site:
http://www.ncbi.nlm.nih.gov/cgi-bin/BLAST/nph-newblast?Jform=0
 

To use this, all you have to do is paste in your sequence (note: for PROTEINS, use "BlastP"), and then click on the particular line of interest.  In this case, the RED lines are the best matches.
 
 

http://www.ncbi.nlm.nih.gov/PubMed/
 
 

Chromosome Icon  Back to the syllabus

Leaf bar # 16